[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ21961.1


[Show Plain Result]

## Summary of Sequence Search
   1::337
  33::297  PF00268 0.0% 23.921568627451  Ribonucleotide reductase, small chain 
   1::337


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNTKIIQPPKEEIVKPQKMGLLVENPVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSE
PF00268         --------------------------------hpdilelykkavanrWlaeevdlskDikdvek.Lseae


                         -         -         *         -         -         -         -:140
query           KNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAF
PF00268         refykfvlaflaaad.dlvnenlveslsaeveikdiehyygeqeaiEnvHsevYsliletlikdekerea


                         +         -         -         -         -         *         -:210
query           MKYKEMKDKYDYMQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDE
PF00268         lvaaieedpaikkkvqwlla.kvadaeslaekl.vafilvEgifFsssFasiaylkkrgllpglcqsnel


                         -         -         -         +         -         -         -:280
query           TLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIA
PF00268         IsRDEalHtsaacllynnllkk..ekpe...ekrieellreaveieiefie.akapvkvlllnveaikqy


                         -         *         -         -         -         -         +:350
query           NRRLSQLGLEPIYDVDKNPLTWLDSMLNAVEHMNFFEGRSTEYSKAATQGTWTEAFS-------------
PF00268         vefvAdrllvelglkkl-----------------------------------------------------