[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ22049.1


[Show Plain Result]

## Summary of Sequence Search
   1::202
  99::183  PF01227 0.0% 63.5294117647059  GTP cyclohydrolase I 
   1::202


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLVEDTDSKILDTKKVSDKEAEEAFKTILTWMGEDPSREGLLETPKRVVKAFKEYFGGYTEDAEKILEK
PF01227         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TFGDVEGYDDMVVEKNISVSSHCEHHMAPIVGTAHVAYIPNERVVGLSKLARVVEVFSKRLQTQERLTMQ
PF01227         ----------------------------PffgkahvaYiPngkvvglsklarivevfarrlqvqErlteq


                         +         -         -         -         -         *         -:210
query           VAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNYFLGEFKKDLSVQNRYLRFISK--------
PF01227         iadalsellkpkgvaVvieAeHlCmtmRGvekpgsktvtsalr---------------------------