[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ22059.1


[Show Plain Result]

## Summary of Sequence Search
   1::189
   2::183  PF02525 0.0% 33.9080459770115  Flavodoxin-like fold 
   3::99   PF03358 0.0% 16.6666666666667  NADPH-dependent FMN reductase 
   1::189


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQAGEDVLDHRRRIEKCDI
PF02525         -mkiLiinahprpeksfssalaqafvealeeagphevtvrdLyad.flpvlttrdlalayeekp.adves
PF03358         --kilvisGslrkgsntrklaewaaealaeagaevelidladl.ilplcdedleeesddlqellekiaaa


                         -         -         *         -         -         -         -:140
query           IVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLN
PF02525         eqiekllaadvivlqfPlwwfgvPailKgwiDrvftagfaf.y....teeggegsgggLkgkkalvivtt
PF03358         dgviivtPeYngsypgllKnalDrlskke-----------------------------------------


                         +         -         -         -         -         *         -:210
query           LPIRRLKRGVFHMCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI---------------------
PF02525         GgpeesygerglegaamdellrplrgvlgfiGikdlepvlveg---------------------------
PF03358         ----------------------------------------------------------------------