[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ22091.1


[Show Plain Result]

## Summary of Sequence Search
   1::388
   9::374  PF00465 0.0% 36.4902506963788  Iron-containing alcohol dehydrogenase 
  14::113  PF01761 0.0% 23  3-dehydroquinate synthase 
 137::296  PF01761 0.0% 22.8187919463087  3-dehydroquinate synthase 
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSNVVG
PF00465         --------Ptkivfgkgaleelgeelkkl..gkvlivtdkslkklglldkvlesLkeagievtvfdgvep
PF01761         -------------igeglleklsellkellkgkklvvvtdenvaklygekveellkeagievevlvlpeg
PF01761         -------------igeglleklsellkellkgkklvvvtdenvaklygekveellkeagievevlvlpeg


                         -         -         *         -         -         -         -:140
query           NPTGTNVNEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIA
PF00465         eptleeveeaaalareekadvivAvGGGsviDtAKaiallltnpgelldye....gkakkkkkpalplia
PF01761         ealktletleklldalleagltrksvlialGGGvigDlagfaA-----------------------rfiq
PF01761         ealktletleklldalleagltrksvlialGGGvigDlagfaA-----------------------rfiq


                         +         -         -         -         -         *         -:210
query           VPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYCA
PF00465         iPTtaGtGsevtplavitdeegkrklsiaspkllPdlaivDpeltltlPkrvtaatglDalthalEayvs
PF01761         vPTtllaqvDssvGgktainlp...egknligafa.qPkaVliDldvLktlperelraGlaEvi..Kygl
PF01761         vPTtllaqvDssvGgktainlp...egknligafa.qPkaVliDldvLktlperelraGlaEvi..Kygl


                         -         -         -         +         -         -         -:280
query           PGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQKGLGAIHSLSHPVNALNNIH
PF00465         kkanplsdalaeealrliaenlpravadpedleareqmllastlAGlafsnaglgaaHalahalgglfgi
PF01761         ikdaelfelleeeeeaelaakrdeealeelikr..sieskaavvaaDekegglral...lnlgHtfgHal
PF01761         ikdaelfelleeeeeaelaakrdeealeelikr..sieskaavvaaDekegglral...lnlgHtfgHal


                         -         *         -         -         -         -         +:350
query           HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDID
PF00465         pHGeavaillpavlrfnaaaaperyarlaralgvdegsdeealaeeliealrellkelglptsLkdl.gv
PF01761         EallgygkllHGeaVa------------------------------------------------------
PF01761         EallgygkllHGeaVa------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RLSKMALADPSTGGNPKKLTEDDMRIMYQNSMTGELFK--------------------------------
PF00465         teedldelaeaalkdqrlannprp----------------------------------------------
PF01761         ----------------------------------------------------------------------
PF01761         ----------------------------------------------------------------------