[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for pubi0:AAZ22111.1


[Show Plain Result]

## Summary of Sequence Search
   1::284
  65::232  PF01493 0.0% 28.3950617283951  GXGXG motif 
   1::284


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANLKNTEKKTKAQSMGMHSEVLTGRTQQKFFNPDEGENLYYFGTYDVDFNKRTELDVKDMTAPEANKEI
PF01493         ----------------------------------------------------------------kiakkl


                         -         -         *         -         -         -         -:140
query           DNLMSQGFGTIVIKNPQGKHSLGVGILNKLNLIFEGSLGYFGMGSCDGPTVRINGRVGWSCAENLMAGKV
PF01493         geeglkkdtgevivrgsaGqsfgaslkggveltveGdandyvGkg.msgGtIvvkgnagdp.....dage


                         +         -         -         -         -         *         -:210
query           VIEKNAGSCFGAAIRGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILGDVGINLGDS
PF01493         yvknvsaGdvvlyGatgGkifvegeaGerfgvrnsgaeivveGnvgdhlgeyMtgGtvvvlGdagrnvGa


                         -         -         -         +         -         -         -:280
query           MYDGTIFIGGKIGSFGSDAVPADLTASDQDWLKRKLKVAEIGEKFDVSKMTKIVAGKKLWNYDNLEPHEK
PF01493         gmsgGtiyvlgeiesgldkkvn------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KGAI------------------------------------------------------------------
PF01493         ----------------------------------------------------------------------