[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ20846.1


[Show Plain Result]

## Summary of Sequence Search
   1::304
  96::303  4.7e-43 33.7% 0037006 00370061 1/1   thione synthetase ATP-binding domain-li 
  96::302  9.9e-42 32.8% 0046457 00464571 1/1   thione synthetase ATP-binding domain-li 
  97::297  1.9e-40 32.5% 0047408 00474081 1/1   thione synthetase ATP-binding domain-li 
  86::298  2.9e-38 32.5% 0047322 00473221 1/1   thione synthetase ATP-binding domain-li 
  96::297    1e-30 27.8% 0044852 00448521 1/1   thione synthetase ATP-binding domain-li 
  95::297  1.1e-30 27.7% 0046656 00466561 1/1   thione synthetase ATP-binding domain-li 
  96::305  1.6e-30 25.9% 0038251 00382511 1/1   thione synthetase ATP-binding domain-li 
  96::298  3.2e-30 25.3% 0036618 00366181 1/1   thione synthetase ATP-binding domain-li 
  97::297  8.1e-29 26.4% 0044434 00444341 1/1   thione synthetase ATP-binding domain-li 
  86::304  2.6e-28 31.6% 0035215 00352151 1/1   thione synthetase ATP-binding domain-li 
   1::96   2.1e-27 48.4% 0047407 00474071 1/1   P-grasp domain                          
   1::95   1.2e-25 43.2% 0046456 00464561 1/1   P-grasp domain                          
  97::302  1.9e-25 26.1% 0044272 00442721 1/1   thione synthetase ATP-binding domain-li 
   2::95     1e-24 43.6% 0046561 00465611 1/1   P-grasp domain                          
  64::304  1.8e-21 25.7% 0050408 00504081 1/1   thione synthetase ATP-binding domain-li 
  99::305  1.2e-19 25.4% 0034972 00349721 1/1   thione synthetase ATP-binding domain-li 
  96::284    4e-19 24.4% 0035376 00353761 1/1   thione synthetase ATP-binding domain-li 
  93::273  4.6e-11 20.9% 0045447 00454471 1/1   thione synthetase ATP-binding domain-li 
  95::298  1.1e-10 20.5% 0038243 00382431 1/1   thione synthetase ATP-binding domain-li 
  92::267  0.00035 24.0% 0046632 00466321 1/1   thione synthetase ATP-binding domain-li 
   1::304


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFNALHGQFGEDG
00370061   1/1  ----------------------------------------------------------------------
00464571   1/1  ----------------------------------------------------------------------
00474081   1/1  ----------------------------------------------------------------------
00473221   1/1  ----------------------------------------------------------------------
00448521   1/1  ----------------------------------------------------------------------
00466561   1/1  ----------------------------------------------------------------------
00382511   1/1  ----------------------------------------------------------------------
00366181   1/1  ----------------------------------------------------------------------
00444341   1/1  ----------------------------------------------------------------------
00352151   1/1  ----------------------------------------------------------------------
00474071   1/1  lklkvavlfGGlsserevsllsaaavlkaLdklgyevvlididkdllllllllkvdvvfpllhGllGedG
00464561   1/1  kklkvavlfGGlssEhevSllSaaavlkaLdkekyevllilidkdglwlllellllllllddllllllll
00442721   1/1  ----------------------------------------------------------------------
00465611   1/1  -klkvavlfGGlssEhevSllSaaavlkaLdklekyevllilidkdglwllldllllllllkslllllll
00504081   1/1  ---------------------------------------------------------------Gfliena
00349721   1/1  ----------------------------------------------------------------------
00353761   1/1  ----------------------------------------------------------------------
00454471   1/1  ----------------------------------------------------------------------
00382431   1/1  ----------------------------------------------------------------------
00466321   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           YIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYIKFNHKKNKLNIIKLIEKNLKFPVVV
00370061   1/1  -------------------------DKvlakellakagipvppgvvltsleellllaleaaeelgyPvvv
00464571   1/1  -------------------------DKlltklllaeagipvppgvlvtsleea......aaeelgyPvvv
00474081   1/1  --------------------------KllakqllaeagipvppgvlvtssdlllldleealaaaeelgyP
00473221   1/1  ---------------NspeairlagdKllakellaka.iptppglplptllvtsleealefa....eelg
00448521   1/1  -------------------------dkylakellkkagiptpkgavatspeealeaae....eigyPvvv
00466561   1/1  ------------------------gDKllakellaeagiptppyalvtsleealeaae....eigyPvvv
00382511   1/1  -------------------------DKllakellakagiptppggvatsveealaaaeeig....yPvvv
00366181   1/1  -------------------------DKllakellakagipvppglllavvtsleealaaaee.igyPvvv
00444341   1/1  --------------------------Kllakellakagipvppgllavat...sleealaaaee.lgyPv
00352151   1/1  ---------------nspeaialamdKlltkkllaklqkklglagvpvpptsil...ed....akelaek
00474071   1/1  tlqgllellgiPytgsgvlasalamD--------------------------------------------
00464561   1/1  elllllllllllllllllevdvvfp---------------------------------------------
00442721   1/1  --------------------------Kllakellakagipvpptlvat....sleealaaaeeigyPvvv
00465611   1/1  lllllllgllllllllgllllevdv---------------------------------------------
00504081   1/1  ilaqvlevagipl..........agdkvlakellkkagipvaPdllyegavvtsleealeaaeei....g
00349721   1/1  ----------------------------lfkelleelgiptpkyavatsleealaaae....eigyPvvv
00353761   1/1  -------------------------Dkllakelleklglptapyalvdslee....llaaaeelgyPvvv
00454471   1/1  ----------------------laldkyeakellakagipvppggvatspeeaveaaeei....gyPkvV
00382431   1/1  ------------------------gdKl....llakaglpvPptlvas...dleealeflee.lg.pvvl
00466321   1/1  ---------------------rlaldeyqakellkeygipvpkgivatsaeealeaaeel....gykpvV


                         +         -         -         -         -         *         -:210
query           KPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAK
00370061   1/1  KpaagggGkGvsvvkneeeleealeeaffydsevlvEefiegarEievqvlgdgkgnvvvlgerecslqr
00464571   1/1  KparggggkGvsivrseeeleaaleealegddevlvEefiegreievlvlgdggevvvlpvveiipgngi
00474081   1/1  vvvKpaaggggkGvsvvrneeeleealelalegddevlvEefiegreievlvlgdgvlpvvelvdpkgfy
00473221   1/1  yPvvvKpaggggGkGvrivkneeeleaaleealseddpvlveefiegpreirvlvlgdgvlpaierspeg
00448521   1/1  KpsggagGrGvvvvkseeeleealeealgealvgsgdgpvlvEeflegrEisvlvlrdgegvvvliiasd
00466561   1/1  KpaggggGkGvrvvrseeeleaaleealeeslfgdgevlvEefiegareisvlvlrdgdgvvi.......
00382511   1/1  KpsggggGkGvrvvrseeeleealeealgealagsgdgevlvEeflegreisvlvlgdgggvvvlavaer
00366181   1/1  KpaggggGkGvrvvrdeeeleealeealeealagsgdgpvlveeflegareievlvlgdgegvvillge.
00444341   1/1  vvKpagggggrGvrvvkseeeleealeealgealagfgddpvlvEeflegareievlvlgdgegavvll.
00352151   1/1  lgyPvvvKplyggsGkgvvkveneeeledalelaalldspvlveefidggrdirvqvlgdkvvaavrrii
00474071   1/1  ----------------------------------------------------------------------
00464561   1/1  ----------------------------------------------------------------------
00442721   1/1  KplygggGrgvrlvrdeeeleaaleealeeaasgdgpvlveeflegpereirvlvvgdevvaavirrh..
00465611   1/1  ----------------------------------------------------------------------
00504081   1/1  yPvvvKpsrggggrGvrivkseeeleaaleealaespgspvlveefiegareyevdvladgdgevvalgi
00349721   1/1  Kp...G....vsvvyneeeleeal....dhpvlveeflegakEvsvdvvrdg.ggvvilgiiehieea..
00353761   1/1  KparggYgGkgvsvvkseeeleaale..gdgevlvEefvegdreisvlvlrdgdgevv.......fyplv
00454471   1/1  vKasvglgGrgkaGGvrlvkseeeleeaaeellgevlvtlqtalagspvdgvlveefldgarElyvgvvr
00382431   1/1  KpldgsgGrgvflvededelldaleelltlsgngpvlvqeylpgikegdirvlvvggevvaailrrvpag
00466321   1/1  vKaqvlagGrGkailhksdvGGVklvl.sleeakeaaeeilgkvlvtkqtglaglpvngvlveefldgar


                         -         -         -         +         -         -         -:280
query           YNSSAKTKHLIPVDLSKNNLAKITGIARAAHKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLSLVPE
00370061   1/1  rhqkfydyeakyhtggsieeappadlsdelreeirelavkaakalgyrglarvdflldedgepyviEvNt
00464571   1/1  ydgeakyslgrrhqksievapaplsdelleelrelalkaakalglrglarvdffvdedgevyvlEvNprp
00474081   1/1  dgdaky.rtggvievapaplsdelleeirelalkaakalglrgllgvdflldedgepyvlEvNtrpglte
00473221   1/1  gfl...........sntggpaalspelleeireialkaakalgyrgllgvdflldkdgepyllEvNprpg
00448521   1/1  hggvyiedvgvntgg.siavapaplseelleeireialkiakalgleglayvgllgveflltdgepyvlE
00466561   1/1  fevdenvqrngvhsgevapaplsdelleelreialkaaralgyvgllgveffvddgelyviEvnprpgvt
00382511   1/1  hqk..vgiedagvhtggsgavapaptltdelleeireiavkptldglaakalgyvgvlgveflldkdgep
00366181   1/1  ...rdhdagvhtggsieeapaptlseelleeirelalkaaralgyvGllgveflvddgelyvlEvNprpg
00444341   1/1  ...gerdesagvhtggvieeapaptlseelleeirelalkaakalgyrGllgvdflvdedgelyviEvNp
00352151   1/1  ...egdwkanvh....ggslepapls....eelrelalkaakalgglglagvdflvdkdgelyvlEvNtr
00474071   1/1  ----------------------------------------------------------------------
00464561   1/1  ----------------------------------------------------------------------
00442721   1/1  ..gdviaevhagg...salvaplte....elrelalkaakalgl.glagvdflvddgelyvlEvNprpgv
00465611   1/1  ----------------------------------------------------------------------
00504081   1/1  recsvgihtgdsie.........vapaltlpdelleelreaalklakalglvgaggveflvdpkdgepyv
00349721   1/1  gvhtgdsgvvlppatlsdelleelreiakkiaralglrGllnvdffvtddevyviEvNprpsrt....vp
00353761   1/1  eniqrngilvgsvaPaplsdelleeareialkiaealgyvGvlgveffvtgdgllvnEvnprphnsghvt
00454471   1/1  drvfgnvvllgsmeGGvdiesvgrhsgdlievapadaltgllrerarelalklglalgyvgal-------
00382431   1/1  ...gdfrsnlal.ggsaeaaplteelrelalkaaralkel.gl.gfvgvDii...g.pyvlEvNvrsppg
00466321   1/1  Elylgilldrafgvvlli....asgeGGvdiEevadvapelipkivvdalegltdei-------------


                         -         *         -         -         -         -         +:350
query           IAKHKGISFIKLIEWILKDASINR----------------------------------------------
00370061   1/1  rpgvtgtslhpvtekatgidlve-----------------------------------------------
00464571   1/1  gltghslvpllakatgidlael------------------------------------------------
00474081   1/1  tslvpvtekatgidlve-----------------------------------------------------
00473221   1/1  lglvehppleaalgidlf----------------------------------------------------
00448521   1/1  iNprpgdtehpllelat-----------------------------------------------------
00466561   1/1  gpv....tlkatgidla-----------------------------------------------------
00382511   1/1  yviEvNprpgdpehpvvlkat...g---------------------------------------------
00366181   1/1  vtgpvtekatgidlvela----------------------------------------------------
00444341   1/1  rpgvsgpvtekatgidl-----------------------------------------------------
00352151   1/1  pgleglv........tgidlakli----------------------------------------------
00474071   1/1  ----------------------------------------------------------------------
00464561   1/1  ----------------------------------------------------------------------
00442721   1/1  tgp......ekatgidlaelil------------------------------------------------
00465611   1/1  ----------------------------------------------------------------------
00504081   1/1  lEvNpRpggehp.ltekat...gv----------------------------------------------
00349721   1/1  lvskatgvslaelalraalglplpe---------------------------------------------
00353761   1/1  llat------------------------------------------------------------------
00454471   1/1  ----------------------------------------------------------------------
00382431   1/1  flgielatgidlaeliad----------------------------------------------------
00466321   1/1  ----------------------------------------------------------------------