[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ20908.1


[Show Plain Result]

## Summary of Sequence Search
   1::611
 522::610  1.1e-23 41.6% 0036422 00364221 1/1   domain 2-like                           
 531::612    7e-21 54.9% 0051452 00514521 1/1   domain 2-like                           
  20::104  3.1e-20 42.4% 0040970 00409701 1/1   IG endonuclease                         
 539::610  3.8e-19 40.3% 0051684 00516841 1/1   domain 2-like                           
 545::612  1.3e-15 44.1% 0051966 00519661 1/1   domain 2-like                           
 548::611  1.9e-14 45.3% 0050778 00507781 1/1   domain 2-like                           
 556::611  2.5e-13 42.9% 0047794 00477941 1/1   domain 2-like                           
 554::609  7.5e-13 49.1% 0052275 00522751 1/1   domain 2-like                           
 193::248  3.2e-11 32.1% 0036773 00367731 1/1   minal UvrC-binding domain of UvrB       
 559::611  7.1e-09 34.0% 0049536 00495361 1/1    N-terminal domain-like                 
 549::605  8.7e-05 24.6% 0036157 00361571 1/1   domain 2-like                           
 557::613  0.00046 26.3% 0048851 00488511 1/1    N-terminal domain-like                 
   1::611


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSSELGKDVIRKELPLIPKSPGVYRMLDHKDVILYVGKAKNLPNRLKSYVAEKNHIIRTARMLSQTFKL
00364221   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00409701   1/1  -------------------nkpgvYlitnkangklYvGkakdLkkRlssyfnglgagftktrllvrailk
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EITTTANESEALLLEANLIKKHKPKFNILLKDDKSFPFVFISNKDQWAQVTKHRGKKDKEGFYFGPFASA
00364221   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00409701   1/1  ygenfvllileevtdselealllEnylikllrpr------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GTANWTIKMLQKIFQIRVCDDSTFKNRKRPCILYQIKRCSGPCVDYIDKEDYKKSVDQAIQFVSGKSRDI
00364221   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------lelveevalllkgeleel
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QKNLSKQMEEASEKLDFERASIFRDRIKSLNIIQSSQRINEANLIDADVIAAYKESGKTCIQVFFYRSKQ
00364221   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ikeLekemleaAeeleFEeAarlRdqilaLkkllekqk--------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NWGNQAYFPKHDPDQSLSEIMSSFLMQFYENKNVPKLIIINTEIEDKKLIEETLSKKENSAISINVAKKG
00364221   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TKAKVIAMAEKNAKESLNRKIYETNNNKNLFEGVAKKFDLKNGLNLVEVYDNSHISGTNSVGAMITFGNE
00364221   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GFVKKRYRKFDIKTKGNEQDDFAMLKEVLTRRFKRAMLEKGNYLTLPDLILIDGGKGQYSSAKEVLDEFG
00364221   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LHDLPMIAIAKGKLRNSGDETFFYKGKSFKFDKNDPTLFFMQRLRDEAHRFAITSHRAKRAKGITKSLLD
00364221   1/1  -------------------------------eklieqLvllglirdeadlfaltlerllrlkglgeksad
00514521   1/1  ----------------------------------------lqrlrdeahrfnitahr..........lll
00409701   1/1  ----------------------------------------------------------------------
00516841   1/1  ------------------------------------------------hrlaiighrklrllerllsaLt
00519661   1/1  ------------------------------------------------------ihrskrskllllllll
00507781   1/1  ---------------------------------------------------------skrtklarlllll
00477941   1/1  -----------------------------------------------------------------lllll
00522751   1/1  ---------------------------------------------------------------allslLd
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  --------------------------------------------------------------------Ll
00361571   1/1  ----------------------------------------------------------tleerelfelLl
00488511   1/1  ------------------------------------------------------------------idll


                         -         -         -         *         -         -         -:630
query           QIDGIGSIRKRALLNHFGSARAVESASFDEIKSVEGVEEKVAKKIYNFFHE-------------------
00364221   1/1  nlleaiekskeislerllfalgIpgvGektakkLlkhfgslealleasve--------------------
00514521   1/1  siPgvgpknakaLlkhfgsleelanasleeLaevlg.geelAkkiyeflhke------------------
00409701   1/1  ----------------------------------------------------------------------
00516841   1/1  gipgvgpvlakaLlehfgsleallaasleeLaevpgiGpkkaesikdfle--------------------
00519661   1/1  gipgvGpktakaLlehFgslealleasleeLaevpgigeklaesiveffsee------------------
00507781   1/1  gipgvGpktakaLlkhfgslealleasleeLaevegigeklaesiveffse-------------------
00477941   1/1  gipgvGpkraklLlkhfgslealleAsveeLaevpgigeklAesileflse-------------------
00522751   1/1  eipGigpkrrkkLlkhfgslkkvkeasveel.kveGiseklaeeiydll---------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  dipgvgeklakkLleaGfgsledlayasveeLleiegigeelaeklieaar-------------------
00361571   1/1  svsgiGpklAlailsvlgleelleaiaegdleaLlkvpgiGkkta-------------------------
00488511   1/1  elpgvgealakkLleaGfltvedlayasveeLleieglseekaekiieaarkl-----------------