[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ20910.1


[Show Plain Result]

## Summary of Sequence Search
   1::293
   9::288  2.3e-83 37.4% 0036320 00363201 1/1   noacid aminotransferase-like PLP-depend 
   7::290  2.7e-79 36.0% 0034852 00348521 1/1   noacid aminotransferase-like PLP-depend 
   2::290  1.9e-77 36.4% 0037053 00370531 1/1   noacid aminotransferase-like PLP-depend 
  10::281  2.3e-69 36.8% 0037168 00371681 1/1   noacid aminotransferase-like PLP-depend 
   1::293


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIPYDKRSGKIWFNGELVDWADAKIHVLNHGLHYASCVFEGERVYDNSIFKLEEHTSRLFYSAKRMGIKI
00363201   1/1  --------givwvngelvpyeeaklsvldrglhygdgvFEtlraydgrlfrldeHleRLlrsaarlglpl
00348521   1/1  ------gsgivwvngelvpyeeaklsvldrglhygdgvFEtlraydgkdgsilfrldeHleRLlrsaarl
00370531   1/1  -pdgellfsvairtlvlseeladldlenlvfggiftdsmlvaeyseigwlngelvpleeaklspldhglh
00371681   1/1  ---------iiwlngel....eaklsvldrgllygdgvFEtlrvydgrlfrldeHlaRLlrsaaalglpl


                         -         -         *         -         -         -         -:140
query           PYTEEEINLASKKIISVQGVKDGYVRPTIWRGSEMMAISAQQTKIHVAIATWEWGSYFDPKLKIEGIKLN
00363201   1/1  pldleellealrelvaanglgdlyirllltrgsgglgvappdleapllvialpvgpylkeealevgirli
00348521   1/1  glplpldleellealrelvaanglgslyirllltrgggslgvappdeakptllviasplgaylseellek
00370531   1/1  yGdgvFEglrayrgedgsirlfrldeHleRLlrSarrlgl.ppldleellealrelvaanglwvPpgggg
00371681   1/1  pldleelrell...laanglgdgyirllvtrgvgglgvappdaleptllviasplpayl.aellekgvrv


                         +         -         -         -         -         *         -:210
query           ISNWRRPAPNTIPWDTKASGLYMICTLSKHEAEQQGYTDSLMLDHEGNVAEATGANIFFKDKNGEIHTPI
00363201   1/1  tsraarg....lladaKt.lnylanvlakleakeagadeallld.dglvtEgstsNlflv.kdgelvTPp
00348521   1/1  gvrlilspdrrrappggllaakktlnylasvlakreakeagadeallldedgevtEgstsNvflv.kdge
00370531   1/1  slyiRplltrgggslgvappd.ealllviaspvgaylkegllekgvrlilssfrraapgglg.daKtggn
00371681   1/1  ilssdrraapdllp.giK.tlnylanvlakreakeagadeallldedgevtEgstsNlflv.kdgtlytP


                         -         -         -         +         -         -         -:280
query           PDSFLDGITRRTVIEIAKSKGIKVNERKIAPAELSNFVGCFLTGTAAEVTPVSCIAENKFKVCETIIDLN
00363201   1/1  lsggiLpGitrqsvlelarelgieveerpitldelleadevfltgtaagvtpVveidgrvigdgkpgplt
00348521   1/1  lvtPplsggiLpGitrqsllelarelgieveerpitldelleadevfltgtaagvtpVveidgrvigdgk
00370531   1/1  ylpsllakreakeagadeallldgedgevtEgstsNvfivkdggegelelvTPplsggiLpGitRqsvle
00371681   1/1  plsggiLpGitrasllelarelgieveerpitleelleadevfltntlagvtpVveidgrvigdgkvgpl


                         -         *         -         -         -         -         +:350
query           ESYQALVRKRKAA---------------------------------------------------------
00363201   1/1  rkLrelll--------------------------------------------------------------
00348521   1/1  pgpltrkLre------------------------------------------------------------
00370531   1/1  lardlgeiev------------------------------------------------------------
00371681   1/1  t---------------------------------------------------------------------