[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21022.1


[Show Plain Result]

## Summary of Sequence Search
   1::924
 513::924 3.1e-135 44.0% 0043905 00439051 1/1   NA polymerases                          
 510::924 3.5e-133 44.5% 0053016 00530161 1/1   NA polymerases                          
 508::924 3.7e-133 42.9% 0042977 00429771 1/1   NA polymerases                          
 508::924 8.1e-133 42.7% 0040062 00400621 1/1   NA polymerases                          
   7::179  9.5e-55 48.5% 0035546 00355461 1/1   omain-like                              
   7::179  6.3e-53 48.4% 0045055 00450551 1/1   omain-like                              
   7::171  2.6e-50 48.1% 0049616 00496161 1/1   omain-like                              
 318::508  2.6e-49 35.6% 0047793 00477931 1/1   uclease H-like                          
 323::531  3.4e-49 38.6% 0051397 00513971 1/1   uclease H-like                          
 327::507    2e-47 41.7% 0053015 00530151 1/1   uclease H-like                          
 246::545  1.4e-43 27.2% 0053000 00530001 1/1   uclease H-like                          
 179::283  4.1e-36 50.5% 0051042 00510421 1/1    3' exonuclease, C-terminal subdomain   
 334::508  2.5e-35 40.8% 0049035 00490351 1/1   uclease H-like                          
 180::294  3.8e-33 50.9% 0045961 00459611 1/1    3' exonuclease, C-terminal subdomain   
 180::287  2.6e-30 49.5% 0049264 00492641 1/1    3' exonuclease, C-terminal subdomain   
 180::294  3.9e-28 43.8% 0049934 00499341 1/1    3' exonuclease, C-terminal subdomain   
 180::293  4.1e-26 40.2% 0045727 00457271 1/1    3' exonuclease, C-terminal subdomain   
 180::295  3.1e-25 36.9% 0048139 00481391 1/1    3' exonuclease, C-terminal subdomain   
 180::293  7.8e-23 37.5% 0045875 00458751 1/1    3' exonuclease, C-terminal subdomain   
  13::195  6.3e-21 25.6% 0040885 00408851 1/1   omain-like                              
  13::195  3.9e-16 26.5% 0034922 00349221 1/1   omain-like                              
  12::179  1.3e-14 24.1% 0049265 00492651 1/1   omain-like                              
 345::585  4.6e-09 21.1% 0046881 00468811 1/1   uclease H-like                          
 344::518    2e-08 24.7% 0050648 00506481 1/1   uclease H-like                          
 345::532  3.2e-07 19.7% 0049562 00495621 1/1   uclease H-like                          
 336::526  4.2e-07 17.9% 0051245 00512451 1/1   uclease H-like                          
 108::229  9.8e-05 21.5% 0036422 00364221 1/1   domain 2-like                           
 346::503  0.00033 24.5% 0049323 00493231 1/1   uclease H-like                          
 327::505  0.00079 22.5% 0044818 00448181 1/1   uclease H-like                          
   1::924


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDKIKKTDHFYLIDGSGYIFRAYYALPPLTRKSDGLPVGAVSGFCSMLFKLLEDSKSNENLQKPTHFAVI
00439051   1/1  ----------------------------------------------------------------------
00530161   1/1  ----------------------------------------------------------------------
00429771   1/1  ----------------------------------------------------------------------
00400621   1/1  ----------------------------------------------------------------------
00355461   1/1  ------llklllleslkgkllliDgssllyrayyalpd.ltnsdglptnavygfllmllkll......e.
00450551   1/1  ------kkkllliDgssllfrafya.........glptnavygflnmLlkllkelk.......pdhiava
00496161   1/1  ------kkkllliDgssllfrayfalpkllltnsdglptnavygflnmllkllke.......lkpthivv
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ------------iDasiwlyrflfavrlelglpllnsgglttshllglfyrllkll.........elgik
00349221   1/1  ------------IDasiwlyqllfalaeklgppllnsk.geltshllglfkrllllle.........lgi
00492651   1/1  -----------aIDasiwlyrlllavrsddgplllalgglptshlrglfsrllkLlelgikpvfVfDGkp
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FDAARKTFRNEIYSDYKANRSEAPDDLAPQFEYIRKSVVAFNLPSVDLPNYEADDLIATYVEQILAKGAK
00439051   1/1  ----------------------------------------------------------------------
00530161   1/1  ----------------------------------------------------------------------
00429771   1/1  ----------------------------------------------------------------------
00400621   1/1  ----------------------------------------------------------------------
00355461   1/1  .lgpthivvvfDgggptfRrelypeYkanRkkapeelleqlelikellealgipvveapgyEADdviatl
00450551   1/1  fDaggktfRhelypeYKanRkkmpdelllqlelikeallllldelkllealgipvlelegyEADDviatl
00496161   1/1  vfDgglgktfRkelypeYKanRketpeelllqlelllelllplikellealgipvlelegyEADDviatl
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  pvfVFDgkapplKketlekRkerreealeellelleegkaeeavklfrravdvtpelieevkellkllgi
00349221   1/1  kpvfVfDglppplkretlakrrerreealeellelleeglleeavklfsrlvdvtpeliellkellkllg
00492651   1/1  pplKletlakrrerreealekllelleegkaeavklfrrlisvtpelirelkellrllgipyivap.yEA
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  -------------------------------------vfPtlcPvcgselvrgevalrclnllcpaqlle
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VTIVSSDKDLMQLYRKDVRIFDPMKNKFITPEDIVTKFGVGPEKVIDVQSLAGDSSDNVPGVPGIGVKTA
00439051   1/1  ----------------------------------------------------------------------
00530161   1/1  ----------------------------------------------------------------------
00429771   1/1  ----------------------------------------------------------------------
00400621   1/1  ----------------------------------------------------------------------
00355461   1/1  aklaaekglvvlivsgDkDllqlvsenvlvllpkkg.ll-------------------------------
00450551   1/1  aklaaeeglevlivsgDkDllqLvsenvsvllplkgvll-------------------------------
00496161   1/1  akkaaeeglevvivsgDkDllqlvdlenvtl---------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  --------------------------------------GvtpeqlidllaLlGdssDnipgvpgiGpktA
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ---------------------------------------vtpeqlidllaLlGDssDnipgvpgiGpktA
00492641   1/1  ---------------------------------------ltpeqlidlaiLlG..sDyipgvpgiGpktA
00499341   1/1  ---------------------------------------ltpeqlidlaiLlG..sDyipgvpGiGpktA
00457271   1/1  ---------------------------------------ltreqlidlaiLlG..sDYippgvpGiGpkt
00481391   1/1  ---------------------------------------ltreqlidlaiLlG..sDylppgvkGiGpkt
00458751   1/1  ---------------------------------------ltreqlidlaiLlG..sDYlppgvpGiGpkt
00408851   1/1  pyvvAp.yEAeaqcAyLak....lglvdaviteDsDlllfgakrvlrnlslsg.l---------------
00349221   1/1  ipyvvap.yEAeaqcAyLak....lglvdaviseDsDlllfgadrvlrnld....---------------
00492651   1/1  daqcAyla....ktglvdavlseDsDll.lfgaprvirn-------------------------------
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  rlihfvsrdaldieglgeklieqLvllg.lirdeadlfaltlerllrlkglgeksadnlleaiekskeis
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AELINKYGTLEKLLDNAQEIKQNKRRETLIENKDKAIISKKLVTLMKDAPVERKLEEFHLKKIDKNKLYK
00439051   1/1  ----------------------------------------------------------------------
00530161   1/1  ----------------------------------------------------------------------
00429771   1/1  ----------------------------------------------------------------------
00400621   1/1  ----------------------------------------------------------------------
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  -----------------------------------ilkpqllfkdlvdnliellflpllkekpnalkiln
00510421   1/1  lkllkeygslenllenldeikgkklreklleelelaflsrelatlktdvpleldledlllgepdfeelrv
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  lkllkeygslenllenldeikg.klreklleeaelaflsrklatlltdvpl..dlellkllepdleelle
00492641   1/1  lkllkeygslenllenldeikfpflkarellleplvlaplslklvtldldvlleflleel...gfdeerl
00499341   1/1  lkllkeygslenilenldeikgkvpeeflfeeaelaflspkvadiktdvlvwln........pdleklie
00457271   1/1  Alklikeygslelllpelfplk..karelflnplvldplslklatpdldvlieflleel...gwseervl
00481391   1/1  Alklikefgslenllelpedfpnkkvrelflnplvtallslklatpdldllleflleel...gwdeervl
00458751   1/1  Alklikefgslelllevpeefpflkarelflnplvldplslklvtpdlellveflleelgwseervdell
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  lerllfalgIpgvGektak---------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FLREMEFNRLLSSVISAYGEPLLEETAKETKPEKKHQNISKKNYHLITNEKEIDEWINEAEEAGELAIDT
00439051   1/1  ----------------------------------------------------------------------
00530161   1/1  ----------------------------------------------------------------------
00429771   1/1  ----------------------------------------------------------------------
00400621   1/1  ----------------------------------------------------------------------
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  -------------------------------------plllddyelidtleeleelleelldakvvalDt
00513971   1/1  ------------------------------------------ldytlvdteeeleelleelldakvvalD
00530151   1/1  ----------------------------------------------iltleeleelleella.glvaldt
00530001   1/1  ellllivelellfnlllnpyeleidnlsvpeslllkeelllllplletdivlidteeeleelleelknak
00510421   1/1  lle-------------------------------------------------------------------
00490351   1/1  -----------------------------------------------------eallarlteaevvafdt
00459611   1/1  llveleffsllrvl--------------------------------------------------------
00492641   1/1  lellekl---------------------------------------------------------------
00499341   1/1  flveelefssllvd--------------------------------------------------------
00457271   1/1  klllkllfklllk---------------------------------------------------------
00481391   1/1  elllklllalllrev-------------------------------------------------------
00458751   1/1  llllkllllrtqs---------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  ----------------------------------------------------------------Pmrfvv
00506481   1/1  ---------------------------------------------------------------nlvvlDl
00495621   1/1  ----------------------------------------------------------------ilvfDi
00512451   1/1  -------------------------------------------------------lllllllltfvvlDl
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  -----------------------------------------------------------------lsfDI
00448181   1/1  ----------------------------------------------sdwidtlrflltllsgpkvvglDv


                         -         -         -         -         *         -         -:420
query           ETSSLDAHQTDLVGISLSTKIGQACYIPIGHKFKGCLKKETVIKKLKPLLEDKSVKKIGQNIKFDFIVLY
00439051   1/1  ----------------------------------------------------------------------
00530161   1/1  ----------------------------------------------------------------------
00429771   1/1  ----------------------------------------------------------------------
00400621   1/1  ----------------------------------------------------------------------
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  EttgldpyrgrivliqlatgdgeavlinpghtdedladalsldevleaLkelledpgilkvghnakfDlk
00513971   1/1  tEttgldpyrgrlvliqlat.ggeaylidllhl.gd.......laaLkelledpsilkvghnakfDlkvL
00530151   1/1  ettslnyhtaelvglalav.ggeayyiplah........alvlealkplledpkipkvghdaKydlvvLa
00530001   1/1  viavDtEtvslrtyrgklcLiQiat.gdgvylidllal.......gedlelLkelledpnilKvghgake
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ettgldpmtadlvglalalg....gyvplahlelgl..............edddvlkvghnaKydlvlla
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  fDlETtGldpekdrIieiaavlvdengeiidepfstlvkpldgvlispeatlitGitdemladaplfeye
00506481   1/1  EttgldpktdlriieiaavlvdgglifdtlvkpgreisdeatelhGitpedladapsfaevlkelleflk
00495621   1/1  ETtgllpegdriieigavdllddeefledapdeke......lllaflellkdadll..vghNgagFDlpf
00512451   1/1  ETTGldpegdriieigavlvdgglleglllllsedglllrvvdrfetlvnPgrpippeateltGitdeml
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  EtvtgleggfPdpekdedeiisIslv.ydggedeivlrlvfplgecaleidgvtvlvfpsEkelLlafle
00448181   1/1  Ewvpsisgylskvallqlcsgnr.cllidllvlpdepvvdyltrvsgireeslklatktlllllrlvkll


                         -         -         +         -         -         -         -:490
query           KQGINMNSMEDTMLMSYVLDAGKNRHNMDTLSEIHLQHKTISFKEIVGTGKKEINFSDVELDKAMEYAAE
00439051   1/1  ----------------------------------------------------------------------
00530161   1/1  ----------------------------------------------------------------------
00429771   1/1  ----------------------------------------------------------------------
00400621   1/1  ----------------------------------------------------------------------
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  fLarlgielpgpvfDtllaarlldpglkshsLddlaerylgieldkserlsgwgarpltfddvdleeqle
00513971   1/1  ardlgielagvfDtmlaayllgpglr.hsLdalaerylgve.......ldkgeqlsdwsarplseeqley
00530151   1/1  rlgielkgvafDtmLaaYLldPsrsshdlddlalrylglelisdeevygkgakqltf...dlevlaeyaa
00530001   1/1  DlevLqrdfgillvnlfDTqiaakllglg..rvgLaaLvekylgvkl.......dKkeqlsdWrarPLse
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  rrGielepldDtlLlaylldPg..shglddlaerylgheli.........................yaae
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  vlkefleflkkpgailvghNainFDlpfLrkefkrlglppyltnrllgnsviDtlelaraayrllpgllk
00506481   1/1  g..ailvghnasfDlrfLrrelprlgildllvidtlllardlsglk.slsldalakrllglg.iple...
00495621   1/1  LkrrlkllglerpllpplrviDtlvlsrllfpdllaldlglpgkllgshsLealgerlgilkg..eledg
00512451   1/1  adaplfaegldlaevleeflefle.ggavlVaHNgasFDlpfLraelerlglplpldlpvlDtlvlarrl
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  llldpdil.vgyNgdnFDlpyLleRakllgiplsrlgrlkksrdkygniaGrhlDllrllrrlsyslyal
00448181   1/1  ddvpkdLlrlLadpsvlkVGvglseDlkkLkldhgleianllDlrilaadslgllllerlslkklveevl


                         *         -         -         -         -         +         -:560
query           DADITYRLYKIFSKNLKLEKLTNIYEIFEKPLIKILAFMEIEGIKIDNKFLKVLSEKFEKKISKLEKEVF
00439051   1/1  ----------------------elllelehplalvlarmernGilldveyleellaelleelaeleeeiy
00530161   1/1  -------------------gllelllelelplalvlaemelnGilvdvelleelsaeleeeleeleaeiy
00429771   1/1  -----------------eegllplllelelplalvlaemernGilvdvelleellaeleeelaeleeely
00400621   1/1  -----------------ergllplllelelplalvlarmelnGilvdvelleellaeleeelaeleaely
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  yaalDalallrlyeklle----------------------------------------------------
00513971   1/1  aalDalallrlyekllelleeegrlellleelelplvrv..-----------------------------
00530151   1/1  edadatlrlaevlleeL-----------------------------------------------------
00530001   1/1  eqleYAalDvhyllelydklleelleegllewlleesellllrvllkmepegiwl---------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  dAlvtlrLlevlkprLee----------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  wplnekglpsykLealakalgiplegaH...............................rAldDaeatae
00506481   1/1  ...............graHdAleDarat------------------------------------------
00495621   1/1  fvalllwkglekyddldwldlleellhyalqDvlvlaeLylk----------------------------
00512451   1/1  lkllslllrlpglksysLdalakrllgipleg....----------------------------------
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  glklesysLdava---------------------------------------------------------
00448181   1/1  g.........vdldk-------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KISKKEFNIASPKQLGEIIYNDLKIAVLKKTRKGSFATNASVLEDLAFKGHEFPKLILDWRQVSKLKNTY
00439051   1/1  elagplielkksvellllkdgllllldlpllkldkvgkllkllklkdgkllllklqklpgllellgpltk
00530161   1/1  elaglefnlnspkqlaeiLfeklglpvl.kttkggpstdeevlekla.ddhplakllleyrklakllsty
00429771   1/1  elaglefnlnspkqlgevlfeklglpvkkktktggqystdeevleela.dlhplakllleyrklakllst
00400621   1/1  elaglefnlnspkqlaeiLfeklglpllkktktgqlstdeevleela.elhplakllleyrqlakllsty
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  llklllkklp.klleyllkllnkls---------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SDALPEHINPNTKRVHTSFLLAATTTGRLASSDPNLQNIPIKSEDGKDIRKAFIAEKGFTLISADYNQIE
00439051   1/1  leleefnlgspkqlaevLfeklgl.plkkttkggystdeevlekladelkelhplakllleyrklaklls
00530161   1/1  vdallklivdkdgrihtslnqtgtaTgRlsssnPnlqniPkrtelgreiRsafvappegyvlvsaDysqi
00429771   1/1  yvdgllklvvdsdgrihtsfnqtgtaTgRlsssgpnlqniPkrdelgreiRrafvapegyllvsaDysqi
00400621   1/1  vdgllklvvpkdgrihtsfnqtgtvTgRlsssgpnlqniPkrdelgreiRrafvapegyllvgaDysqiE
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           MRILADLAEVKELKKAFSNNEDIHSLTASQVFNVDIKKVDQDMRRKAKAINFGIIYGISQYGLAKQINVS
00439051   1/1  tyvegllkllnlvdkdgrihtsfnqtgtaTgRlsssnPnlqniPsvrteygseiRaafvapfglkgllle
00530161   1/1  ElrvlAhlsgdealleafreglDihtatasllfgvpleevtkelRrkaKavnfgliYGagafgLalqlgi
00429771   1/1  ElrvlAhlsgdealleaflegtDiHtatasllfglpleevtkelRrkAKafnfgllYGagakglakllgi
00400621   1/1  lrilAhlsgdealleaflegtDiHtatasilfgvpleevtkelRrlAKvfnygliYGagakglakllgis
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           NHEADEFLNAYFLKFPEIKIYMDNTIKFCRKSGYVTNIFGRRSHFNGINDKNFNVRNFQERAAINAPIQG
00439051   1/1  gyllvgaDysqiElriLAhlsgd......fdsgtDlhsltasiifgvnveevtgelRrlAKtfnyGliYG
00530161   1/1  sveeakelidayfeaypgvkkyledvveaarekgyvetllGrrrylpdinsknlllrsfaeraavntpiQ
00429771   1/1  sleeakelidryfeaypgvkkflekveeaalekgyvetllGrrrylpdinsrnlllrnfaersavntpiQ
00400621   1/1  leeakelidryfeaypgvkkylekveeaalekgyvttllGrrrylpdinsrnrllrnfaersavNtpiQg
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           SASEIMRLAMIRLNKKFESIKNNKSKILLQIHDELIFEVPVKEVKNITEIIKDEMTSVTESDLHTFSTPL
00439051   1/1  agakglakllgiseeeakelidryferypgvkrylekvkeearkkslwlgyvetlfgrrrylpeidspnt
00530161   1/1  gsAadilklamvrvdralkelgl.garlvlqvHDElvlevpeeeaeevaelvkeamena.....vkldvp
00429771   1/1  gsAadilklamvrleral...yglkarlvlqvHDElvlevpeeeaeevaelvkeamena.....vklsvp
00400621   1/1  sAadilklamvrleralle.lgldarlvlqvHDElvlevpeeeaeevaellkeamena.....lklsvpl
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           TVDVNTGDNWGILH--------------------------------------------------------
00439051   1/1  pvr..aeraavNtp--------------------------------------------------------
00530161   1/1  lkvdvkvgknwgea--------------------------------------------------------
00429771   1/1  lvvevdigknwgea--------------------------------------------------------
00400621   1/1  vvevdigknwreak--------------------------------------------------------
00355461   1/1  ----------------------------------------------------------------------
00450551   1/1  ----------------------------------------------------------------------
00496161   1/1  ----------------------------------------------------------------------
00477931   1/1  ----------------------------------------------------------------------
00513971   1/1  ----------------------------------------------------------------------
00530151   1/1  ----------------------------------------------------------------------
00530001   1/1  ----------------------------------------------------------------------
00510421   1/1  ----------------------------------------------------------------------
00490351   1/1  ----------------------------------------------------------------------
00459611   1/1  ----------------------------------------------------------------------
00492641   1/1  ----------------------------------------------------------------------
00499341   1/1  ----------------------------------------------------------------------
00457271   1/1  ----------------------------------------------------------------------
00481391   1/1  ----------------------------------------------------------------------
00458751   1/1  ----------------------------------------------------------------------
00408851   1/1  ----------------------------------------------------------------------
00349221   1/1  ----------------------------------------------------------------------
00492651   1/1  ----------------------------------------------------------------------
00468811   1/1  ----------------------------------------------------------------------
00506481   1/1  ----------------------------------------------------------------------
00495621   1/1  ----------------------------------------------------------------------
00512451   1/1  ----------------------------------------------------------------------
00364221   1/1  ----------------------------------------------------------------------
00493231   1/1  ----------------------------------------------------------------------
00448181   1/1  ----------------------------------------------------------------------