[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21058.1


[Show Plain Result]

## Summary of Sequence Search
   1::967
 171::543  2.1e-92 30.8% 0050394 00503941 1/1   in diphosphate-binding fold (THDP-bindi 
 135::571  2.8e-90 28.6% 0049028 00490281 1/1   in diphosphate-binding fold (THDP-bindi 
 180::543  1.9e-86 31.1% 0044439 00444391 1/1   in diphosphate-binding fold (THDP-bindi 
 181::590    5e-85 30.3% 0041402 00414021 1/1   in diphosphate-binding fold (THDP-bindi 
 168::601  3.7e-62 22.4% 0036596 00365961 1/1   in diphosphate-binding fold (THDP-bindi 
 594::814  1.6e-50 36.2% 0051963 00519631 1/1   in diphosphate-binding fold (THDP-bindi 
 606::814  2.2e-49 37.3% 0039059 00390591 1/1   in diphosphate-binding fold (THDP-bindi 
 611::814  8.7e-49 35.3% 0044440 00444401 1/1   in diphosphate-binding fold (THDP-bindi 
 609::830    1e-48 31.8% 0042965 00429651 1/1   in diphosphate-binding fold (THDP-bindi 
 340::560  1.8e-35 24.3% 0049136 00491361 1/1   in diphosphate-binding fold (THDP-bindi 
 610::820  3.6e-32 32.8% 0041403 00414031 1/1   in diphosphate-binding fold (THDP-bindi 
 611::820  1.3e-23 25.8% 0050395 00503951 1/1   in diphosphate-binding fold (THDP-bindi 
 373::550  5.5e-14 17.5% 0042762 00427621 1/1   in diphosphate-binding fold (THDP-bindi 
 349::544  1.4e-08 19.6% 0044101 00441011 1/1   in diphosphate-binding fold (THDP-bindi 
 349::547  1.6e-05 19.3% 0039197 00391971 1/1   in diphosphate-binding fold (THDP-bindi 
   1::967


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSSSKNLEFEKTSFLSKSNSAFIEQMYLKFINKDKDLPESWQNYFEGMSEDLSMIAKEINGPSWNIKKKI
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DIDEVEKRIEEDEKKLSNEGNIAKVNSKDLVKSNINSIRAVALIRAYRQRGHLLAKLDPLGMMETEYLDE
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------relvp.
00444391   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LHPEHYGFKKENYDEKIYLDGVINKEHSSIKEILNFLNKTYCGPIGYEYMHISNPTERKWLRDRIEQDEN
00503941   1/1  ------------------------------reildllektycgsigvelmhildllgriwlpedle....
00490281   1/1  ldl.ylglteadldrefdlggllglelltlreilallkktycgsigveymhildlegr.wllerles...
00444391   1/1  ---------------------------------------aysghlgaelgvvlltlhlvfdpprpe....
00414021   1/1  ----------------------------------------gvveltvelirvldldgllwlksgheg...
00365961   1/1  ---------------------------alrrllidallkavsghpghllglagivevlfalhlvfd.ppn
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SLQFTKNGKEAILMKLIQAEGFEKFLHKKYVGTKRFGLDGGEGLIPALEQIIKIGGQAKVKEVKIGMSHR
00503941   1/1  ..klskeellelyrlmllareleellldlvrqgkighlgsslGqealavllaaalr.......prdrivl
00490281   1/1  ...lspeellellrlmlliralelrlvlla.gsgrgghllslagqeallvalalal......npedpvig
00444391   1/1  ...lsdeellqlyrhmlltrrfeefllllqrqgkrgffvlsaGhealavgaalalrgg......edvigm
00414021   1/1  ...lsldvllqlyrhmlltrrfeefltllqpggkirgffilseGhealavglalalr.......gedvlg
00365961   1/1  pdwlsrdvllqlyrhmlltrrfeefltllqrqgkigrfvlsaGhealalyaalalr.......gydvifp
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GRLNVLANVLQKSYKRIFNEFAGDIQTSGEEGAGDVKYHLGASSNREFDGNSVHVSLTDNPSHLEAVNPV
00503941   1/1  gHrghllyl..llgldllkifrelggk......sgghpvsehlg...............vlfntghlgtg
00490281   1/1  d.hRdrlvll..ghgspllyaflelrg..kledlsggrdgsyhpgh..........pelgvefttghlgt
00444391   1/1  ayRgrlnvla..lgvplleifaellg..klpghpgggdvkmhlg..........seslgvlfntghlgtg
00414021   1/1  mayRgrlnvla..lgvplkeilaellg..lrtglskgggvpmhlgspg............llgntghlgt
00365961   1/1  tYRdhgllla..lgvdllkifrelggklpg..hpeggggsmhlgsetpgve..........pttgplGtg
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  -----------------------------------------------------------ttgplGtglpv
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  --------------------------------------------------------------------sa
00391971   1/1  --------------------------------------------------------------------pa


                         -         -         -         -         *         -         -:420
query           VLGQTRAKQFFHKDKERNKVIPILIHGDAAFAGQGVVTECFAMSGLPGHNTGGTIHIIVNNQIGFTTSPR
00503941   1/1  lpvAvGmAlAlkllgk.....dvvvvaliGDGal.seGvvhEAlnlAgllkl...pvlfvvedNgigist
00490281   1/1  glpvAvGmalalkllg.....pdrvvvaviGDGa.lseGvvhEAlnlagllkl...pvlivvvdNgigis
00444391   1/1  lpvAvGaAlAakllgk.....drvvvaliGDGal.seGvvhealnlaallgl...pvlfvvvNNqigist
00414021   1/1  glpvAvGaalAakllgk.....drvvvaliGDGal.seGvvhEalnlaalykl...pvlfvvvnNqigis
00365961   1/1  lpaAvGaAlAaklagp.....drvvvaliGDGal.seGmvhEalnlagllkl...pvlfvvenNgyaist
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  AvGaAlalkllgelfnrglldlvdrvvvaliGDGa.lseGvvweAlnlagl..lklpnlifivdnNgysi
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------vafiGDGal.seGvfhEalnlAgv..lkldnlifvvdnNgysisgpvg
00441011   1/1  AvGaAlalkllgalfnrglldlpdrvvvafiGDGalse.Gvshealnlagh..lklgnlifildnNgysi
00391971   1/1  AvGaAlaakllgalfnrplldlpdrvvvaliGDGal.neGvslealnlAgh..lkldnlivivdnNgysi


                         -         -         +         -         -         -         -:490
query           FARSSPYPSDVAKMVDAPILHVNGDDPEAVVYATRIATEFRLKFNRDVVVDLICYRRFGHNEGDEPSFTQ
00503941   1/1  pvgrsrssedladraeafgipvirVdGhdveavyaalkeakeyaregggPvlieavtyrgkghseadddp
00490281   1/1  t.pvdlrssayedlaarfeayGipvirvdGhDpeavyaalkeAleyarkgggPvlIeaktyrgkGhsead
00444391   1/1  pvgrqrstpdladraeafgipgirVdGnDveavyaalkeaveraragggPvlieavtyRgkghseaddps
00414021   1/1  tpve..rssayptllaeafgipgirVdGndveavyaalkealeyarkgggPvlievvtyrgkghseaddp
00365961   1/1  ptglatasedlaaraeayGipgirVdGndvealyaalkealerarsgggPvlIevvtyrgkghstaddps
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  sgpvsral.sedladrfeayGwpvirvidGnlDveavyaalkealerg...ggPvlieaktyrgkghsee
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  gqt.ledlaarfeayGwnvirvvdGhDvlavyaalkeaker...gggPtlIeakTykgkglplaegtlka
00441011   1/1  sgpvglas.ledlakrfeayGwnvirviwdGhdveavyaalkeaker...gggPtlIeakTykgkghsle
00391971   1/1  dgpvglql.ledlakrfeayGwnvirvdGhsldveavyaalkeaker...gdgPtlieakTykgkghppa


                         *         -         -         -         -         +         -:560
query           PLMYKKIRSHPTPVEMYGKKLVNENTLSESELSKFKTDFKNLLDDQYKNAKDYKPKIEWYEGTWSRYKPE
00503941   1/1  skyhgkeeveiekkrdpierfakylleegllteeeleelleevaeeveeavae-----------------
00490281   1/1  dptkyrgpeeveairkrd.piplleevlieegvlteeelkeiekevraeveeavelaeelpellagllpd
00444391   1/1  kyrgkeeveiwkkkdpilrlrkylieegllseeeleelleevraeveeaveea-----------------
00414021   1/1  skyrpveeyeeirkhrdpilrlakylieegllteeeleeilkevreeveeaveeaekspk..pdlsdlfd
00365961   1/1  kyhgkpevdeerahrdpilrlrkylleeglldeeelfaieeevreeveeaveeaekapkpspeelfddvy
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  ddpkahrvpldkeeiealrerdpllrlaeflipeglldeaeelkeivaeaaaeveealeaaeeplpdlae
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  Hgvpldpeeyralkevlgwplepdpiprlrkyllelgllgeeelaeldeelvaivaaape----------
00441011   1/1  ddakaHgvylgkeevealrkrlglppedlflvpddpiarlraylleegllteee----------------
00391971   1/1  egttkaHgvylgkeevealrkrlglptgeflvpdpilrlykylleeglleeaeldel-------------


                         -         -         -         *         -         -         -:630
query           KGKDKRGVSGYDQQKLLEISEKINATPEKLKLHKTIVKILDARKASVSNGKGIDWSTAEALAFGSLLEEG
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  plelfedvyae-----------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00414021   1/1  dvyaela...........ellkeivailaa----------------------------------------
00365961   1/1  aelpel..............lkeivailaalpegfperlfd-----------------------------
00519631   1/1  ---------------------------------lvlkfiletrlklleegkkidyreafglalaelleed
00390591   1/1  ---------------------------------------------elekgkkltyreafglalaelleed
00444401   1/1  --------------------------------------------------kkltyreafgealaelleed
00429651   1/1  ------------------------------------------------kgkkltyreafgealaelleed
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  -------------------------------------------------gkkltyreafgealaelleed
00503951   1/1  --------------------------------------------------kkltyreafgealaelleed
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           YPVRLVGQDSGRGTFSQRHSVLRNQEDNSRYIPLNNISKNQMRYEIVDSFLSELAVLGFEYGYSLVEPNT
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00519631   1/1  prvvllgeDvgrgtvlkvtaglfdkfgpdr...............vfdtpiaEqgivgfaaGlAla..Gl
00390591   1/1  prvvllgedvgrgtglfrvtv..............glfakfgpdrvfdtgiaEqaivgfAaGlAlagl..
00444401   1/1  prvvllgedvgrgtglfrvtv..............glfakfgpdrvfdtpiaEqaivgfaaGlAla..Gl
00429651   1/1  prvvllgedvgrgtglfrvtv..............glfakfgpdrvfdtpiaEqgivgfaaGlAlagl..
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  prvvvlgedvgrggglfrvtv..............glfakfgpdRvidtpiaEqgivgfAaGlAlaGl..
00503951   1/1  prvvvlgedvgegggvfr..............vtkglfakfgpdRvfdtpiaEqgivglAaGlAla..Gl
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LTIWEAQFGDFANGAQVVIDQFIASGERKWTRASGLVMLLPHGYEGQGPEHSSARLERFLQLCANDNLQV
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00519631   1/1  rPvveiqfsdflnrAfdqiindvallryrsggeqkv....pvvlallpaglggdgpthhsasdeallrli
00390591   1/1  rPvveaqfsdflnrA...fDqiindvallryrsggklnvplvlrlpgglvgedGptHsssdlalfrhlP.
00444401   1/1  rPvveaqfsdflnrAfDqivndvailryrsggnlpvplvlrlpggvggdgpthhsledeallrli..pgl
00429651   1/1  rPvveiqfsdflnrAfdqivndvallryrsggqqnlpvvlrlphgglggdGptHsssdlalfrhlp...g
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  rPvveaqfsdfl...qrafdqivndaallryrsggklnvpvvfrlpggavggdGptHsg...edlallra
00503951   1/1  rPvveiqfsdfllrAfdqivndaaklryrsggqqnlpvvirlprgggadgathhsqsdeallrhi..pgl
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LNCTTPANYYHALRRQMHREFRKPLIIMTPKSLLRNKHCVSNIEDFGKDNFFHRILWDHALDEENGFIKL
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00519631   1/1  ..pglkvvaPsdpadakgllraairdd..gPvvvrepkglyrlk--------------------------
00390591   1/1  ..glkvvaPsdpaeakgllraairdd..gPvvirepkgllrlvl--------------------------
00444401   1/1  kvvaPsdpadakgllraaird..dgPvvirepkgllrlvlevse--------------------------
00429651   1/1  lkvvaPsdpadakgllraair..ddgPvvirepkgllrlkeevpeeeyllpigkaevlre----------
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  ipglkvvaPsdpaeakglllaair..ddgPviirepkglyrvvlevpe.e--------------------
00503951   1/1  kvvaPsdpadakgllraaird..dgPvvfrepkglyrlvlevvpleefti--------------------
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           KESSKIKKVILCSGKVYFDLLEAREKLKKDDVVLYRIEQLYPFPVKSLVREIKKYAKNANFYWCQEEPKN
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           MGAWFSVRDYIQWTLETINANNTGISYIGRSPDASPATGYAKRHLAQQQEIIKKVFE-------------
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00519631   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------