[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21098.1


[Show Plain Result]

## Summary of Sequence Search
   1::422
  15::194  4.4e-30 28.8% 0046490 00464901 1/1   inding domain                           
  16::193  8.1e-24 30.4% 0046342 00463421 1/1   inding domain                           
  15::210  1.1e-23 31.6% 0050017 00500171 1/1   inding domain                           
  15::193  3.1e-22 26.1% 0044931 00449311 1/1   inding domain                           
  15::192  1.5e-19 29.7% 0047231 00472311 1/1   inding domain                           
  15::194  1.8e-19 27.1% 0046672 00466721 1/1   inding domain                           
  15::193  3.2e-19 29.6% 0047282 00472821 1/1   inding domain                           
 249::421    5e-18 23.1% 0046489 00464891 1/1   inked oxidases, C-terminal domain       
 165::418  2.5e-05 19.0% 0046341 00463411 1/1   inked oxidases, C-terminal domain       
 401::417    0.024 52.9% 0050336 00503362 2/2   inked oxidases, C-terminal domain       
 167::206     0.55 30.0% 0050336 00503361 1/2   inked oxidases, C-terminal domain       
   1::422


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKNSQIFQDSNNTYYPEDELQVSNLVQELYKKNQPTEIIGTGSKNFIGNNIQSAKKLSMSKLSGVIEYL
00464901   1/1  --------------vrPesveevaaivklarehgipvvprggGtsllvggsvplgrggvvidlsrllnki
00463421   1/1  ---------------lPtsteevaaivklanehgvpvvprgggtsllggalplgvdggvvldlsrmnril
00500171   1/1  --------------vlpesveevaallklanehglpvlplGggsnllggd.lfdgvvi.lsrlngileid
00449311   1/1  --------------vlPrsveevaaavklarehalsglpvvvrggghsllggalpaggvvldlsrlnrie
00472311   1/1  --------------vlPesteevaailklanehglpvvvrGggtnllggdvgfdgvvidlsrlnki.eid
00466721   1/1  --------------vlPrsteevaavlkacvelglpvvprgggtgltggavplgsdydrgvvvlslerln
00472821   1/1  --------------vlPrsteevaalvklaaehglpvvprGggtslsggavpdgslvlgglvlslsrlng
00464891   1/1  ----------------------------------------------------------------------
00463411   1/1  ----------------------------------------------------------------------
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PEELYIKVKANTPLELVEKELEKNNQELAFEPIDFGFIENGKSNKGTIAGHLACNFAGSRRFKVGSLRDH
00464901   1/1  leidpeggtvtveaGvtlgdlyealaehglelalpldp........gscitvtvGGaiagn..Gigslry
00463421   1/1  evdpedltvtVeaGvtlgdlyealaehgltlpvdpg..gsa........tigGvialtnagGlgslryGl
00500171   1/1  epedltvtveAGvlladlvealaehgl.fgleplsgip........gtiGGaiatnagg.....yGveir
00449311   1/1  llellevdpeggtvtveaGvtlgdlyealaehglalpvdg.slpt........vtvGGliaggghgtlsl
00472311   1/1  ed..tvtvgaGvlladlvealaehgl.lgleplsgip........gtiGGaiatnagg.....yGletrd
00466721   1/1  rileid.egltvvvepGvtladlnealaplgllfppdp........gsagisatigGnvatnagGllvlr
00472821   1/1  ilevdlsaedltvtveAGvvladlaeala.........khglalpnlpsigsatiGGaiatnaggtglll
00464891   1/1  ----------------------------------------------------------------------
00463411   1/1  ----------------------------------------------------------------------
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ILGFRGVNGKGDIIKSGGTVVKNVTGYDLSKLVTGSFGTLVALTEITLKVLPKKKLSNTITIHTDDKKLV
00464901   1/1  GlaadnvlglevvladGeivtasgrllknlyrkslllkntlllllsagpdlfwa----------------
00463421   1/1  trdnvlglevvladGevvrlgaellknsagydlfwalrgglldglfsegtlGi-----------------
00500171   1/1  dlvlslevvdladgeiltlsae..klnfgyrls.lfkgsegtlgiiteatlkllplpkavilalllelld
00449311   1/1  ryGltadnvlglevvladGevvt.....asasegydlfwalrgsegtlGvvte-----------------
00472311   1/1  nvlslevvladGeivtls....kddlgfdlrglflgseg..giiteatlkll------------------
00466721   1/1  ygatrdlvllalvdedgelelvnhlglevvladgevldtlsglrkdllaldlee----------------
00472821   1/1  gGglgllslrygllsdlvlglevvladGevltls....kdelgydlfqallgs-----------------
00464891   1/1  ----------------------------------------------------------------------
00463411   1/1  ------------------------patrllllffgsegtlgeavllliplgipllipglvvllnvlleaa
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  --------------------------pdlvrllrgsYgdlgiftedqlrLiplpegaallllgrfd----


                         -         -         -         +         -         -         -:280
query           KNLFDKISSSSSEVSGAVYIPEEPKDENYDQNKEMVFKFNDLKYKGSFLALRIEGDKIAIDEKIKALTNE
00464901   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00464891   1/1  --------------------------------------vnalglglplllveleGseesvdallerleei
00463411   1/1  llvlrrgelpaalelmddvaleavlallglglpl.......................llveleGseaave
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LELSKLNTTVLDVHQSTPFWKKINNLELFKQTKNNLLRVVVPPSKGPKLIQFLGNKYKYYIDWCGSLYWI
00464901   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00464891   1/1  leelggldvvvaddeaeealwalrkdlppalgalgplgllgiiagavvivldvavppsgkrlaelleeir
00463411   1/1  aqlerleelleelggldavvaqdeeerellwalReaalglvtllelgavgrrpggavlwedvavpllgsr
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EVQSKKNSKVSDIKKLTKELGGYLTIIKTSDEYDYEETIFTVDDIRLLISEKIKKSFDPKRIFNPGKMYR
00464901   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00464891   1/1  elldkyglrvvifghagdGnlhlnilllfdlddpeeleraealldalrelvlelgGsisgehgigllkae
00463411   1/1  laeflreirallaky.glrgvifgh..............agdgnlhlnilllfdlddpeeleraealn--
00503362   2/2  --------------------------------------------------velKaafDPngiLnPGk---
00503361   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GI--------------------------------------------------------------------
00464901   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00464891   1/1  y---------------------------------------------------------------------
00463411   1/1  ----------------------------------------------------------------------
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  ----------------------------------------------------------------------