[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21174.1


[Show Plain Result]

## Summary of Sequence Search
   1::213
   1::188  1.2e-20 25.1% 0050935 00509351 1/1   nosyl-L-methionine-dependent methyltran 
   1::214  3.7e-05 15.2% 0047676 00476761 1/1   nosyl-L-methionine-dependent methyltran 
   1::213


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEEIFKNYPLLKNQNVPRETLIEFDLFISMLQEENEKINIISKETAKNEVIRERHIVDSAQIIEFVDLNS
00509351   1/1  nmllelllklllllglnlseeqyekledyfdllldwnkkynllsskdpd..rlwerhildsllllelldl
00476761   1/1  lldllsllllelglvlsdeqleklealldllldwnpvinltgsrefde..lwlrvlldllallplk..pg


                         -         -         *         -         -         -         -:140
query           NIITDIGSGGGMPGIIISIMIKNQKNLAKVHLYEKSHHKSSFLRKVSRDLKLNTEVMQENIFEAEKLDSG
00509351   1/1  kpgkrvLDlGcGtGllaialaklfpg....akvtgvDispemlefarenakklgldnvefiqgdaedlpf
00476761   1/1  krvLDlGcGtGllalalakll....pgarvtgvDispealelarenaaelgldnvefvvgdaedlp.pdg


                         +         -         -         -         -         *         -:210
query           TIMARAFKPLPIILDLVYKNFNSYKNLIVFMGKNGEKVLEETLMNWDFDFEKKKSITSEDSFLLNIKKIK
00509351   1/1  ellldgsfDlivsrhvadlekllkeaarlLkpgGrlvlsdgssyleel----------------------
00476761   1/1  sfDlvvsnppydlealleelarlLkpgGrlvlstgsrlleeleellegfll.levlpllvplldgerllv


                         -         -         -         +         -         -         -:280
query           KKN-------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00476761   1/1  llek------------------------------------------------------------------