[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21175.1


[Show Plain Result]

## Summary of Sequence Search
   1::264
   1::258  6.8e-64 35.2% 0046842 00468421 1/1   p containing nucleoside triphosphate hy 
   1::263  3.9e-62 33.6% 0047406 00474061 1/1   p containing nucleoside triphosphate hy 
   1::258  8.1e-59 33.6% 0046913 00469131 1/1   p containing nucleoside triphosphate hy 
   2::256  1.2e-58 37.4% 0036095 00360951 1/1   p containing nucleoside triphosphate hy 
   1::238  1.3e-56 34.1% 0037384 00373841 1/1   p containing nucleoside triphosphate hy 
   1::238  7.5e-56 36.6% 0037385 00373851 1/1   p containing nucleoside triphosphate hy 
   1::254  3.2e-52 34.2% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
   1::233  9.2e-28 31.6% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
   2::243  2.9e-19 27.9% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
   1::238  3.9e-18 20.9% 0035779 00357791 1/1   p containing nucleoside triphosphate hy 
   1::195    6e-15 29.9% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   2::205  3.4e-13 26.0% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   2::234  1.8e-12 25.4% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   2::205  1.7e-11 24.4% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
   1::193  1.3e-10 22.6% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
   2::205    8e-09 23.3% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
   1::42     6e-07 36.6% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
   1::135  1.2e-05 28.4% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   1::212  6.4e-05 23.1% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
   3::40   0.00072 43.2% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
   1::264


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTIYGVLNGTRVI
00468421   1/1  mmkviav.sgKGGvGKTTtaanlAaalaelGkkVllvDlDpqgpltdlll..gleae.ptlvdllageid
00474061   1/1  mmkviavtsgkGGvGKTtvaanlAaalaelGkrVlliDlDpqgpslslllglepep...pgladllagea
00469131   1/1  mmkviavtsgkgGvGKTtlaanlaaalaerGkrVllvdlDlpqpslslllglepee...lgladlllglv
00360951   1/1  -kviavtsgkGGvGKTTtaanLaaalarlGkkVllidlDpqgpltdlllgleaeevv.ptladvlggeld
00373841   1/1  MplggkpkviavtsgkGGvGKTTtaanlAaalaerGkkVllidaDpqaslsdllgleaedlpvpvrglld
00373851   1/1  rellllllllllllkgkpkviavtsgkGGvGKTTtaanLaaalaerGkkVllvdaDpqaslsdllgle.g
00387941   1/1  mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgpslslllglegep...lgladllagead
00480251   1/1  EdlslavgkgkvialvG.kgGvGKTTtaakLaaalaergkkvllidlDpyrpsapeqlgilgellg....
00513761   1/1  -kiiaivG.kgGsGKTTllnklaglla.dggkvlvidlDparanlpeqlgi.....dirdlidletvme.
00357791   1/1  MkaifitgtdtgvGKTtvsaaLaralarrglrvavfKPvqtgldstdggledgdalllqalaglllpled
00490731   1/1  dvslsvkkgkvialvG.kgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaee.......
00468601   1/1  -dlslevkkgevialvG.pnGvGKTTllakLagllapqggkvlllgaDiyraaaaerlgigavpqdv.pl
00475371   1/1  -alddvslsikkgevialvG.kgGvGKTTlaanlagllaptggkvlligaDi..................
00448931   1/1  -LddvslsvepgevialvG.pnGsGKTTllnalagllapdggkvllvgadiarla...............
00509891   1/1  pkvigitG.psGsGKTTlanaLarllkarglkvavidrdpgrld..........................
00485931   1/1  -evvalv.GpnGaGKTTllallagllaptggkvllvgadirrigavpqlpvlfprltvlenlalgg....
00484101   1/1  kgpvigivG.psGsGKTTllraLagllkprggrvavigldig----------------------------
00434401   1/1  Mlsksyggllalddvslsvkkgliigit.GpsGsGKTTlaraLaellrerggsvavidlddfyrpaaell
00459701   1/1  MpkvillvGppGsGKTTlakaLakrlgekgvkvvvidtddlrr...........................
00371631   1/1  --mseliiylelselewallradvgltlteaelkrlkgln------------------------------


                         -         -         *         -         -         -         -:140
query           SDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSRATYDYVLIDCPPSLSLLTVM
00468421   1/1  ledliledvlltglegldllpaggllpglaell.....rgpdeaealkellealagdyDyvliDtppglh
00474061   1/1  dlddailptvvegldllpaglplagvellgper..........lrelleelrgdyDyviiDtppglgtlt
00469131   1/1  dledvllktsspgldllpaggplaglelllse..........alrelleelrddyDyviiDtppglgdlt
00360951   1/1  lddvivev.legldllpaggllagle.lllrgvdeaaallelldal....eedyDyvliDtppglgdlgl
00373841   1/1  llageidledailptlvegldllpaglllaglell..lelgrgpggdellalaalrelleaallagdyDv
00373851   1/1  erlpvtvidvlrgledledlive...pgldllpag.llaeleellasrgadeaallrellellka..gdy
00387941   1/1  ledailetp.egldllpaglllagl......ellrgerlrelleel....addyDvviiDtppglgdltl
00480251   1/1  ...................vpvvgvltgldlagalrealell................llegydvvliDt
00513761   1/1  lglgpngalvfaleellttld....................illealelleedydyiliDtpGglelral
00357791   1/1  vnpvllkepasphlaanldgvlid.........................lelilealarlakdadvvlvE
00490731   1/1  ..........................lgldvllgarggdlsggl...rqr..larallgdydvliiDtpg
00468601   1/1  fpsltvldnlala....................................rdlleaa..kaagydvvlidt
00475371   1/1  ...............rrpsarellgllgellgldvlvgarggdlsgglrqr..laral...lgdpdvlli
00448931   1/1  ...areqlgivfqdpgltvlenlalg..................eleararellellgled..ydvvliD
00509891   1/1  ...ldeplgvdrerlrrvgelalllaggglcalvaddlagaleellaralaggpdviliEgagllplpli
00485931   1/1  ...................................adlaeraeellellglegfdvvliDtagrgrrvge
00484101   1/1  ----------------------------------------------------------------------
00434401   1/1  lreglgidfqlpdaldrellreevlellgl.gevvivdvydlsggerqr....aralasgpdv..-----
00459701   1/1  ............eaikqliglglfdedgegalrrreavakllldallkalkagggdvvilDgt.altleq
00371631   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPELKIRGILLTMFDKRNKLSTQVEKEARDYFNE
00468421   1/1  dlglltlaallaadlvlivttpealslqdakrllkllaklrk..npglpvlgvvlNrvdprre..kgale
00474061   1/1  llalaaadlvllvttpellslrdalrllellekl......glpvlgvvlNrvdprrslsle..eelaeel
00469131   1/1  llalaaadlvllvttpellslrdalrllellrkl......glpvlgvvlNrvdprtella..leelaell
00360951   1/1  ltlaallaadgvliVttpealslqdalrllelleklkd..npglpvlgvvlNkvdlrte..ggvleelae
00373841   1/1  viiDtppglgvltllalaaalgrvvkgllalalaleileileelmeelekivellkdpeldlvvlvttpe
00373851   1/1  DvviiDtppglgtlrllelpdvlglyvkglmgelkkitgvltllalaaadevllvttpetlslqdalrll
00387941   1/1  lalaaadgvllVvdpellalraarrllellr......klglpllgvvlNkvdprar..eelleelaeelg
00480251   1/1  agglqrglllalaladlllvllldepllvldatagtellelakg.llealgldgvvltkldlvaal..ga
00513761   1/1  lalllaiaralaadeillvddptsgldaetqleilelllelllkl......gipi.ilvlnKlDllseeg
00357791   1/1  GagglavpllrdlsnadlarlldlpvilVvdig...lgsinaalltleallq...rglrlagvvlnrvrg
00490731   1/1  tldvllelallellkellaelgadvvllvvdat.lgleaadrilvlleglgvp..---------------
00468601   1/1  aglldldrlvgelsggqkqrvaiarala.apevllldept.sgldalaellelleel........-----
00475371   1/1  Depgrgldpellallaelldllrelradlgllvvdath.dldavlkaadrilvldlg........givln
00448931   1/1  tagrlrlpselsggqkqrvaiaralaaplppevllldept.sgldalrellellrel........-----
00509891   1/1  ellrdlldlvvlvvldgivllvda........idrleaadllvlnkldlveia-----------------
00485931   1/1  lsggqkqrvaiarallllldpelllldEptsglda.lrlllellkelgltvlvvthddgtakgga-----
00484101   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00459701   1/1  reallellkel...glpdlvvfldtpleelleRllkrlkrplpgrldrrieeiledlkgrleiyekptep
00371631   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KVYLTVIPRNVRLSEAPSHGMPVLMYDKSCPGSKSYFNFTDEFINQEQTIGSAA----------------
00468421   1/1  elaeelglpvl.gviprdeavreaalagkpvveldpdskaaeayrela----------------------
00474061   1/1  glpvl.gvipldpalaealllglpvvelapdskaakayrelaeellerlelll-----------------
00469131   1/1  glpvlg.vipldpalaealllglplvelapdskaakayrelaeelle.----------------------
00360951   1/1  elglpvl.gvipldeavreaallgepvvelepsskaaeayrelaee------------------------
00373841   1/1  qlaleeakrllellekl......glpvl------------------------------------------
00373851   1/1  ellekl......glpvlgvvlNkvdgra------------------------------------------
00387941   1/1  lpvl.gviprdpalreaalrglplveldpkspaaeayrelaeel--------------------------
00480251   1/1  alsvalilglpilflgtgenvdd-----------------------------------------------
00513761   1/1  ...lelvlelleellellpilllgvgpkdldli-------------------------------------
00357791   1/1  drhllaellealeellg.ipvlgvlpyl------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00475371   1/1  kldlvakg....gaalelaeelgv----------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00459701   1/1  ll--------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------