[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21176.1


[Show Plain Result]

## Summary of Sequence Search
   1::282
  25::182  1.9e-38 34.2% 0044819 00448191 1/1   Sulfiredoxin                            
 112::221  9.2e-31 49.5% 0049120 00491201 1/1   DNA-binding domain-like                 
  27::122  1.6e-26 47.8% 0044920 00449201 1/1   Sulfiredoxin                            
 123::214  6.1e-25 49.5% 0050319 00503191 1/1   DNA-binding domain-like                 
   1::282


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDANKIKKGLGRGLSSLIGETKVEINVNKVSISDLVRNKFQPRKTFDAESLQDLTNSIKERGIIQPIIVR
00448191   1/1  ------------------------islelvplekLrpnklnPrelvdeerveelaesIrefGliqPIvvl
00491201   1/1  ----------------------------------------------------------------------
00449201   1/1  --------------------------ivelpldklvpnplnprlvldpeeleelaesikelgllqPivvr
00503191   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RSSEDNSKYEIIAGERRWLSAQKAGLHEVPVVITNIDDLKSLEFAIIENVQRNDLNVIEEAQGYQRLIEE
00448191   1/1  klleddgtyliidGhhRlrAakkLglkkvPvvvldyldesvsvstWrsgvpfgveqalalalaenlqvie
00491201   1/1  -----------------------------------------lelaliENlqRedlnpiEealaykrlle.
00449201   1/1  pld...gryeiiaGerRlraakllgleeipvivrdlddeealalalieNlqR------------------
00503191   1/1  ----------------------------------------------------edLnpleealaykrlle.


                         +         -         -         -         -         *         -:210
query           FSYDQEKVAQFIGKSRSHIANCLRLLNLPQAVLKLIQTQKLSAGHAKILVGLDNAEFVANKIIEKNLSVR
00448191   1/1  ddkvRenlelieialallgllelalpgelllrqelskildem----------------------------
00491201   1/1  lgltqeeiAkrlgksrstvsnrlrLldlpeevlealeegkislgharallllllkdeeeqlelleailee
00449201   1/1  ----------------------------------------------------------------------
00503191   1/1  lgltqeeiAerlgksrstvsnrlrLlnlppevlealregkislgharallllddeeqvelleliieegls


                         -         -         -         +         -         -         -:280
query           QSENFVKIFKTKKHSLKTSKDINLQVLENSIREKIGLNVLIKNKKNNSGSLLLEYKDLDQLNKIIEIIKS
00448191   1/1  ----------------------------------------------------------------------
00491201   1/1  glsvrqleelv-----------------------------------------------------------
00449201   1/1  ----------------------------------------------------------------------
00503191   1/1  vrel------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NY--------------------------------------------------------------------
00448191   1/1  ----------------------------------------------------------------------
00491201   1/1  ----------------------------------------------------------------------
00449201   1/1  ----------------------------------------------------------------------
00503191   1/1  ----------------------------------------------------------------------