[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21179.1


[Show Plain Result]

## Summary of Sequence Search
   1::844
   1::664 6.8e-137 39.7% 0038403 00384031 1/1   otidylyl transferase                    
   2::665 1.5e-128 38.9% 0037568 00375681 1/1   otidylyl transferase                    
   2::665 1.3e-127 38.8% 0039071 00390711 1/1   otidylyl transferase                    
   2::665 2.3e-121 39.2% 0038030 00380301 1/1   otidylyl transferase                    
  31::667 5.6e-107 40.2% 0043348 00433481 1/1   otidylyl transferase                    
  30::666 9.6e-107 40.8% 0052384 00523841 1/1   otidylyl transferase                    
  30::672 4.4e-106 41.4% 0042947 00429471 1/1   otidylyl transferase                    
  10::665  6.1e-96 39.5% 0040507 00405071 1/1   otidylyl transferase                    
   4::656  6.9e-85 37.4% 0039171 00391711 1/1   otidylyl transferase                    
  16::672    6e-84 33.7% 0038263 00382631 1/1   otidylyl transferase                    
  26::661  1.3e-73 31.6% 0047412 00474121 1/1   otidylyl transferase                    
   3::707    3e-54 31.7% 0039322 00393221 1/1   otidylyl transferase                    
  25::679    2e-52 27.6% 0035691 00356911 1/1   otidylyl transferase                    
   5::727  2.7e-49 27.6% 0048275 00482751 1/1   otidylyl transferase                    
 225::417  9.1e-45 35.5% 0038402 00384021 1/1   /IleRS/LeuRS editing domain             
 222::421  7.1e-41 33.9% 0037567 00375671 1/1   /IleRS/LeuRS editing domain             
 227::416  3.3e-39 34.1% 0049869 00498691 1/1   /IleRS/LeuRS editing domain             
  33::266  1.9e-37 33.9% 0048474 00484741 1/2   otidylyl transferase                    
   1::659  9.7e-21 20.6% 0039570 00395701 1/1   otidylyl transferase                    
   8::728  3.1e-18 24.3% 0047114 00471141 1/1   otidylyl transferase                    
 666::842  4.5e-17 21.8% 0043347 00433471 1/1   odon-binding domain of a subclass of cl 
 665::782  5.4e-17 28.0% 0038401 00384011 1/1   odon-binding domain of a subclass of cl 
 655::803  1.4e-15 24.2% 0039069 00390691 1/1   odon-binding domain of a subclass of cl 
 656::844  1.7e-15 23.6% 0039227 00392271 1/1   odon-binding domain of a subclass of cl 
 663::843  2.3e-07 21.5% 0037566 00375661 1/1   odon-binding domain of a subclass of cl 
  43::716  4.4e-07 23.3% 0053312 00533121 1/1   otidylyl transferase                    
 616::675  2.1e-05 27.8% 0048474 00484742 2/2   otidylyl transferase                    
  34::150    4e-05 24.2% 0047487 00474871 1/1   otidylyl transferase                    
 308::364  0.00029 33.3% 0046954 00469541 1/1   /IleRS/LeuRS editing domain             
   1::844


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRYNFKTVEEKWQKFWHKNKVFSSKLDKTKKKFYCLEMFPYPSGKIHMGHVRNYTIGDVLARYKTLQGY
00384031   1/1  PgfinlklieekllkiweelklfgklflpkgkkkvvvtfppPypnGplHiGHarsailgDvlaRylrmlG
00375681   1/1  -lalyntlnlpleefplrynlkeieekwqkyweekklfeallpllggkkkfyvtdppPypnGplHiGHar
00390711   1/1  -etalpkfynllliekkwqkfweekklfeaflpldpgkkkfyvttppPypnGllHiGHarnyvlaDvlaR
00380301   1/1  -ialpgfinlflieekllklweeeklfeflle.gkkkfvvtvppPypnGplHiGHarsailgDvlaRylr
00433481   1/1  ------------------------------kkkflvtvpppyvngllHlGHarnayilaDvlaRylrmrG
00523841   1/1  -----------------------------gkkkflitvpppyvngplHlGhartyilaDvlaRylrmlGy
00429471   1/1  -----------------------------gkkkflitvpgpyvngllHiGHarnyilaDvlaRylrmlGy
00405071   1/1  ---------elklyntweekklffkpld..kkkvvvtvpgpyvngllHiGHarsyilgDvlaRylrmlGy
00391711   1/1  ---ynpleieeeilkkl............kkkkvvvvrtgpyPtGplHiGhargallgdvlarylrmlGy
00382631   1/1  ---------------lWeeegifekdllkgkkkfvvtrfpPsPtGyLHiGharnallndllarylr..Gy
00474121   1/1  -------------------------fppgkgkkvvversspnptgplHiGHarsavigdalaRllralGy
00393221   1/1  --kenlelierglielwreeelfell...ekkkvrvy.tgpdPtgslHlGhlrgaikldvlara....gy
00356911   1/1  ------------------------pflpgkkkkvvvefssPnptgplHiGHarsaiigdalarllrflGy
00482751   1/1  ----gmslllklllirgllneltdekelfellegkpvrvycGptPtgplHlGhartal...vlarflr.a
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  --------------------------------tk.vvvrfaPnPtGplHiGharsaligdllarylr..G
00395701   1/1  tvelllelierglieqltdee.lldkllngkpvrlytgfdPta.gslHlGh...lvpldklrrfqra.gh
00471141   1/1  -------gmsvdellelllrglyntltd.ekelfklleggpvrvycGidPTgdslHlGh...lvtadvlr
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  ------------------------------------------vdlllelllrglietltdeeelfkllek
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ---------------------------------kvvtRfAPsPtGylHiGhartallnyllaray.....
00469541   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NVLHPMGWDSFGMPAENAARQNNLDPKTWTESNIKTMRSQLKKLGLSIDWDKEISTCSEDYYKHQQEFFL
00384031   1/1  ydvlfvlgiddhGlpiellaekfgedprelaeeyieeikedlkrlgisydwsreyattdpeyieavqeif
00375681   1/1  nyilaDvlaRylrmrGydVlfvpgwDdhGlpielraeklgktpedlgreeflelcrelaeeyideikedl
00390711   1/1  ylrmrGydVlfvpgwDdhGlpielaaeklldiddkiprkelgreefgetprelaeeyiaeikedlkrlgi
00380301   1/1  mlGydVlfvpgwDdhGlpiellaeklgiklllriddlgreeflelprelaeeyideikedlkrlgisfdw
00433481   1/1  ydVlfvpgtDdhGlpielkaekfgetpreladeyidefkedlkrlgisfdw..fyrttdpeyieavqeif
00523841   1/1  dvlfvpgtddhGlpielraeklgidpreladeyiaeikedlkrlgisfdw..fyrttdpeyieavqeifl
00429471   1/1  dVlfvpgwDdhGlpielkaekfgetpreladkyiaefkedlkrlgi..dwdrfyrttdpeyieavqeifl
00405071   1/1  dVlfvpgiddhGlpiellaeefgelpreladeyieefkedlkrlgisfdwfrptatl...yieavqelfl
00391711   1/1  dvlfvlgidDtglpievkaeeegileeylgkpltgipdflgdprelaeeyideikedlkalgidpdwvse
00382631   1/1  fvlriedtD................pereteeyidailedlkwlglswdwsryyqserfdyy...qelfl
00474121   1/1  dVlrvngvddaGtqigllaaslllrgleepedlypieylldlyvklkklaedeeleeeagefllrledgd
00393221   1/1  dvlflig.Dlhgliidpa.......pkelvrenieeikeqllalgl..dp....................
00356911   1/1  dVlrvngiddwGtqiellaeslkllglellgeipeisylgeyyveiakelielgkdy.......tldpel
00482751   1/1  Gydvlflig.Dahgliid.pagelg.lprelveenaaailedlkalgi..dpdkfiitaqseileiv.el
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ydvlridDtD................perlteeyidailedlkalg..idwdeevrtqserl.dayqelf
00395701   1/1  evlvliG.datgrigDpdgkiieralltlelvdenieyikklla.kgldydgpekvtivnnsdwlsklnl
00471141   1/1  rflra.gydvillig.Dltgliddpigkratrvgldpeelrenaieailedlkalgidp...........
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  gpvrvycGidPTgdslHlGhlr..al.dvl.rylqdagydvilliadltdliddkilkraerlgenlldp
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  .............gGkfllrieDtDperevpeavdailedlewlgldwdegpdpggplgvyyqserfdly
00469541   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DLYDKGLVYRKENYVNWDPVDETVLANEQVVDGKGWRSGATVERKKLNQWFFNISKFSEDLLQGLDALEN
00384031   1/1  lklyekGliyrgerpvnycpsdetaladaeveypvcwrskgdpvelrlteqwflklskladrllealeel
00375681   1/1  krlgisfdwdrfyaTtdpeyieavqelflkLyekGliyrgdgpvyycpscetaladrevegypvcwrsga
00390711   1/1  sfdwsrfyrTtdpeyieavqelflkllekgliyrgegpvnydpsdetaladaeveggeypvcwrsgtpve
00380301   1/1  frpyattdpeyieavqevflkllekGliyrgerpvyydpscetaladaev.epvcwrsgtpvevrlteqw
00433481   1/1  lklyekgliyrgegpvnycpscetaladae.....cwrsgtpvevrlteqwflklgklkdrllealekle
00523841   1/1  kLlekGliyrgegpvyycpscetaladlevedpvcwrsgapvevrlteqwflklsklkdkllekldpldf
00429471   1/1  kllekgliyrgegpvyydpsdetaladle.....cwrsgtpvelrateqwflklgkladrllealeege.
00405071   1/1  kllekglayegdgavyydplekegdlgdlelikldgpvcyrsgdpvelkltpqwfvl.............
00391711   1/1  sslyksglykeiitrqseyieliqeilekllekglayekdgtvnflprcktalgdlsvevkk........
00382631   1/1  kLlekGlayrcfctvewlpalrtalaeagvepkyrgrsrelnlelviattrpetlegdyalrl.......
00474121   1/1  pkrladesieeikedlkrLgv..dfdryvresesyysgavqeviekLlekGlayekellvndgavlfrle
00393221   1/1  ......................................................................
00356911   1/1  eelareffrkleegdeeylklwqklvdrsleefkedlkrlgvkfdvyrgestlyidgiievvelleekgl
00482751   1/1  iekLlekglayealnrmvyfd.................................................
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ekllekGlayvcelsveflvelnlfyygrlsngevpe............................leavl
00395701   1/1  idflrdlgkhvsv.........................................................
00471141   1/1  ......................................................................
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  eelae.nieeyaadllalgldp................................................
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  yeaaeeLiek------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WPNKVKVMQKNWIGKSFGCEVEFKIESEKPIESIKCYTTRPDTLFGFSFLALSVDHPLAKYYEEDKEFQK
00384031   1/1  e.wrpevvrkrlewile.....................................................
00375681   1/1  pvevrlteqwflklsklddrllkalkkgefvpeevknrlrnwlen.........................
00390711   1/1  vrlteqwflklgkladrllealesgewippevvrkr..................................
00380301   1/1  flklgkladrllealeegervivpeevknrldnwleg.................................
00433481   1/1  .wpesvknrllnwle.......................................................
00523841   1/1  alwpesvkgellnwleng....................................................
00429471   1/1  wpeevrnrldnwlekg......................................................
00405071   1/1  ......................................................................
00391711   1/1  ......................................................................
00382631   1/1  ......................................................................
00474121   1/1  kfgddgeledrvllksdGtp..................................................
00393221   1/1  ......................................................................
00356911   1/1  lyesdgavyfdltkfgd.....................................................
00482751   1/1  ......................................................................
00384021   1/1  --------------ksegvyvkfplvd..gdeylvvwTtrPeTlpgntavavnpeheyvlvlaegellil
00375671   1/1  -----------wegkspgvyvkfplldslllllkdvylvvwTTrPeTlpgntavavnpeleyvlvlvsge
00498691   1/1  ----------------egiyvkfplvdglllllgdvylvvwTTrPeTlpgntavavnpeleyvlvlvdge
00484741   1/2  rllvdlgklvprdlvlgalwi.dlpgdeddwvivwgdglpgYdlavvvddallgid--------------
00395701   1/1  ......................................................................
00471141   1/1  ......................................................................
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  ......................................................................
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FREECSKTGTTEESIASAEKLGFKTDMIAVNPLDKNMKVPVYFANFVLMDYGLGAVFGCPAHDQRDLDFA
00384031   1/1  ......................................................................
00375681   1/1  ......................................................................
00390711   1/1  ......................................................................
00380301   1/1  ......................................................................
00433481   1/1  ......................................................................
00523841   1/1  ......................................................................
00429471   1/1  ......................................................................
00405071   1/1  ......................................................................
00391711   1/1  ......................................................................
00382631   1/1  ......................................................................
00474121   1/1  ......................................................................
00393221   1/1  ......................................................................
00356911   1/1  ......................................................................
00482751   1/1  ......................................................................
00384021   1/1  aealleellkklllelevlatlkggvltglyvihPlt.grevpvlladyVlldyGTGaVmivPahdedDy
00375671   1/1  llilaeellefllkllglellelevlatlkggvltgllvihPl.tgreipvlladyVlldyGTGaVhiaP
00498691   1/1  llilaeellekllkkelevlatlkggvltgltvihPldlltgrevpvlladyVlldyGTGaVhtaPahge
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00471141   1/1  ......................................................................
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  ......................................................................
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ---------------------------vavhPeDerykdliGklvilPlvgreipiiadeyvdlefGtGa


                         -         -         -         -         *         -         -:420
query           KKYNLKITPVVKPEKDKDFKINNEAYTGEGYLCNSDFLDGLKVPSQSIIKTIEFLEKNNLGTKKTNYRLK
00384031   1/1  .....................................................................g
00375681   1/1  ......................................................................
00390711   1/1  ......................................................................
00380301   1/1  ......................................................................
00433481   1/1  ....................................................................ng
00523841   1/1  ......................................................................
00429471   1/1  ....................................................................lk
00405071   1/1  .....................................................................l
00391711   1/1  ......................................................................
00382631   1/1  ............................................................kidlesglen
00474121   1/1  ......................................................................
00393221   1/1  .....................................................................e
00356911   1/1  ......................................................................
00482751   1/1  ......................................................................
00384021   1/1  efakkyglpiinvidddgllleealelayleegllinsgefaGldvf.eArkaiielLeekglllhs---
00375671   1/1  ahdedDyevakkyglpiinvvd...............edGvltnesgefaGldvf.eArkaiielLeekg
00498691   1/1  dDyevakkyglpiinvv................ddgglfnsgefaGldvl.eAnkaiielLeelgl----
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00471141   1/1  ......................................................................
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  ......................................................................
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  vkitpahdfnDyev--------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DWGISRQRYWGCPIPIAYDENDQPIKIPRDMLPVKLPEIEKLSNTGNPLDSEDNWKFFILDGKKYRRETD
00384031   1/1  lrdwciSRqrywGvpiPvwycescliesvydellpvvlgeleeggllleadgdllsllgdlkdfvllksd
00375681   1/1  ............................lrDwcisRqrpWGvpiPvwhiedgaivyvaediaylllkaie
00390711   1/1  ...................llnwleglrdwciSRqryWGvpiPiwycedlgdvvvieavlelvdpldfvl
00380301   1/1  ....................lrdwcisRqrywGvpiPgwhiedgamvvvllgdgavllpt..........
00433481   1/1  lrdwciSRqrywGvpipvwiekddgkviyvwfdalvgyp..................tglgrpgeklere
00523841   1/1  lrdwcisRqswdrywGvpiPgw................................................
00429471   1/1  dwcisrqrlywGvpiPgw..................................................ek
00405071   1/1  kglkdwaisRqrpwGvpiPgwhi...............................................
00391711   1/1  .....................................wgdgiplykak......................
00382631   1/1  lrDwvisrqrywghdipllrs.................................................
00474121   1/1  ............................................tyllrDlaisrqrfwghpipgwespw
00393221   1/1  kwtifrqsdwgeyiellldlgklt....................................tvgellrrdd
00356911   1/1  .........................dlrdwvisrs...................................
00482751   1/1  ......................................................................
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  l---------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00471141   1/1  ......................................................................
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  ......................................................................
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TLDTFVDSSWYFLRFCSPHNLDRGFTQEEANYWMPVDQYIGGVEHAILHLLYSRFFMQALSYKNDDFKLK
00384031   1/1  gp.leretdvldvWfdSgwgylrvlgyptedlayileklerwfpvdiyvgGkDhirfHflyllavlralg
00375681   1/1  ggtdllltlelldllvlyyvllgklglelkretdvldvWfdSglyylavlgyp..........felgypa
00390711   1/1  wksddlgeplwdlvvlcpkcglelkrdtdvldvWfdSglgylgrlgwpie....csamfekylpvdihvg
00380301   1/1  .......ytfgddgdlvlresdvldtwfdsglyylstl.....dlavdkekfellfpvdiyvgGkDliff
00433481   1/1  tdvldtwfdsg.......................wypadihvgGkDiirfhllyspaillaarmlgllle
00523841   1/1  ..etdvldvWfdsslmylaylgaple......dlfelwwpadihvgGkDliffhllrlialllalgg...
00429471   1/1  dvldvwfdsgiyyieclaapl.lklgdkedfekwwpadgvdelihvgGkDliffhllyslaillalgl..
00405071   1/1  ...dvldvwfdsl.......................glpvdihvgGkDliffhllyeiailealfg....
00391711   1/1  ...........................diadvwfdspwgygrpgyp......lecaaddlllgvdivlgG
00382631   1/1  .dglptyflavvvdd..................allgithvlrGaDhlfntlryillleal.........
00474121   1/1  g...............................................dvlptwfiellayvv.......
00393221   1/1  vkdrw.dssisfgllgYp......llqaadilllgvdivpgGkDqwphhelgreiar.............
00356911   1/1  ...........................dggytYftsdiayaly............rferlgfdkdiyvvg
00482751   1/1  ..dvvdvwfdg.wsiglf.ypllqaa......dilllgadivlgGkDq.ffhlelgralaralg......
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  .nrmlarddfalrledgislgeflYpllqayDflhlecgygvdlqigGsDq.fpnillgrdllrallgl.
00471141   1/1  ..gkayifnnsdylpvlsfldylrlsglvsvnrllrgddvkdrlekdlpisfglftYpllqaadilhlga
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  ..................................ekvtiflnsdvlshl.eladllrglarvgtlnrmld
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EPFDGLFTQGMVCHETYKDQNNKWLSPDEVTSEDGKKFYKKDNPSEKIIVGPTESMSKSKKNTIDPENII
00384031   1/1  dlglltgk.ePfknvlthGlvldellltlllctleflrgrelygyvlrllallkalgleldglplplyhl
00375681   1/1  dihvgGkDiiffhfarllaaslalfg.......kpppknvlhhglvldldg...................
00390711   1/1  GkDiirfhllyslalllalfg.......kpppknvlvhglvldldg........................
00380301   1/1  hflrllailealgg.......kapfkevlhhglvldldg...............................
00433481   1/1  ltgleppknvlvhgfvlldg.....................................eKMSKSlgnvidp
00523841   1/1  .....epfknvlvhglvldldg....................................eKMSKSlgnvvd
00429471   1/1  ......eppknvllhgfvlldg.....................................eKMSKSlGnvi
00405071   1/1  ...leppkyvlhhgfldldg.....................................eKMSKSlGnvitp
00391711   1/1  kDhifphllylpaqrealealg.....leppkvllyhgvvlgldg.........................
00382631   1/1  .glpfpkvlhhglvldldg....................................ekmSKskgnvvvpld
00474121   1/1  ........ddlgfdvdiyvvGadhi.lhferlrailealgllpla.....pppehlhfglvlld......
00393221   1/1  .pfpvllthplll...................................gldGveKMSKSkgnvitlddll
00356911   1/1  adq.llhfaqlfaalaalgy........epakkvlhvgfvl.............................
00482751   1/1  ...lpfpevlthpl..................llgldGeK..................MSKSlgnsvitl
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  .......pkpvglttplllgldG.e....................................KMSKSlgna
00471141   1/1  divlgGkDq.fphhelgralaral.........................ggkpp..yvlhhplllgldG.
00433471   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00375661   1/1  ----------------------------------------------------------------------
00533121   1/1  pkdfvlrkadgiseglftypllqaaDilhlylgegadivpgGsDql.phheleralaralgkk.......
00484742   2/2  -------------------------------------------------------mSK..Gn.vtl..ll
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           KNYGADSVRLFILSDSPPEKDVQWSDQGMLASFKFVQKLWTLNSKILDKIKNNDQGSEGNDLAKFTNQLI
00384031   1/1  vfgflnldge..................KMSKSk------------------------------------
00375681   1/1  ..................eKMSKSlGnvidprdll-----------------------------------
00390711   1/1  .............eKMSKSlgnvidpldllekyga-----------------------------------
00380301   1/1  ......eKMSKSlGnvvtpddllekygadalRlfl-----------------------------------
00433481   1/1  ldlldkygadalRlyllslapygsdldfseeilvgav---------------------------------
00523841   1/1  prdllegygadalRlyllslapygsdldfseellve----------------------------------
00429471   1/1  tpddllekygadalRlfllsalapygsdldfseellvg..rf----------------------------
00405071   1/1  rdlleeygadalRlflls.asyrsdldfseelllg-----------------------------------
00391711   1/1  ...........eKMSKSkGnvitldd--------------------------------------------
00382631   1/1  lidgygdprlptlaglrrrGyladalrlflallgpsksdlnf----------------------------
00474121   1/1  ...............................---------------------------------------
00393221   1/1  eeiakkikkaftdprevygadalryfllsglp.dkdvvfllelltelsldeleelenayrs.....geln
00356911   1/1  ......v.g...kMSkrkGnvvtlddlleeygadalrlflls.kspdsd---------------------
00482751   1/1  ldlleeygadilryfllsgnyrdddvldfselilflaldllnklrnalrfgplllealeelaeeytsgvl
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  iwlddllksiykkiqkalnvydadvlryl-----------------------------------------
00471141   1/1  ................teKMSKSlgnaitlddllekigpkilryydalls.thyrlpldfsleellelld
00433471   1/1  -----------------------------------anklgNllnRtlrfilknldgfvpdleelteldrw
00384011   1/1  ----------------------------------Flnklwnlvrfllenldgfdplldleelslldrwll
00390691   1/1  ------------------------fynklwnalrFllrnlnlfdklldgalpleelslldrwilsrlnel
00392271   1/1  -------------------------ynklwnaarFllrnldgfdp.....dleelslldrwilsrlneli
00375661   1/1  --------------------------------ynklwnalrFllgnlddfdpeedlldveelsllDrwil
00533121   1/1  ...................fpvywlhlplltgldGe..................KMSKSlgnaitldd..
00484742   2/2  degygpdalryfllr.lgyssdldfslealeeavnlafklgnlak-------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           NKITQNLEKFHYNVIVANFYEMYNFLIKEIDKPIKKEILIENYKKILIVMNPFIPHFSNECLSTINENQI
00384031   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00393221   1/1  pgdlkka---------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00482751   1/1  gdgelkkalaealnellkpirealeel-------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00471141   1/1  lllrlknarlaqlrlayelgklvhgelk------------------------------------------
00433471   1/1  llsrlnelikevteayenyefnkalraimelvnlanwYldlskpwllake..dserlravlyvllevlri
00384011   1/1  sklnetikkvtealekyrfntaisalmefvnalsdwylelakdrvllealetllrllaPfaPhiaeelWq
00390691   1/1  ikevteayenyrfntavaalyefvnddlsnwYlelikdrlygeadsearraaltvlyevletllrllaPf
00392271   1/1  kevteayekyrfntalsalyefvwndlsdwYlelikprlyaedrsaqtvlyevletllrllaPflPfiae
00375661   1/1  srlnelikevteayenyefntalsalynfvwndlsdwYleliKdrlygdaadsaarrsaqtvlyevletl
00533121   1/1  ektipekirkallssg------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           SWPEISKEDLIEEDINFVVQINGKKRAILKIKRDVVEKEILEIIKTNLEIEKFLKDKTIKKSIFVPNRLI
00384031   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00433471   1/1  llillaPflPfiaeeiwqqlgleesvhlaswplldghkigkpeplferledeeleelieqlkgliravrk
00384011   1/1  llgggsvllapw----------------------------------------------------------
00390691   1/1  lPfiaeelWqrlplllglggeesvhlaswPevd-------------------------------------
00392271   1/1  elwqrlggeesvhladwpevdeldelleeevelvvqvigklrslraelnipkslplevliaaad..ellk
00375661   1/1  lrllaPflPfiaEeiWqrlpgleeesvhladwpevdelaelideeleelmelvrevikairslrkeknik
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           NIIL------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00433471   1/1  ar--------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  klld------------------------------------------------------------------
00375661   1/1  psl-------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00469541   1/1  ----------------------------------------------------------------------