[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21181.1


[Show Plain Result]

## Summary of Sequence Search
   1::329
  25::329  6.9e-23 28.8% 0053328 00533281 1/1   s                                       
  25::329  7.2e-12 24.4% 0053278 00532781 1/1   s                                       
  16::329  4.7e-08 22.6% 0048764 00487641 1/1   s                                       
  16::329    3e-07 21.6% 0047258 00472581 1/1   s                                       
  23::329  2.3e-05 21.0% 0046462 00464621 1/1   s                                       
  16::329   0.0001 21.0% 0048638 00486381 1/1   s                                       
   1::329


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNLKKIGLTALAGCLAVTSVHASELTASGSASIGFGGADKGTSANGFYMNDEVTFSGSGELDNGWNVTL
00533281   1/1  ------------------------svtlyGsvdlgveytdndgsgtdgtgldngsrlgikgsedlgdglt
00532781   1/1  ------------------------svtlyGvvdagvey.dd..vtsgglsgsraelglkgsedlggglka
00487641   1/1  ---------------aalaaaaqssvtlyGfvdagvtytdnddgdg.glsgsrlglkgsedlgdglkavf
00472581   1/1  ---------------aevyahaqssvtlyGrvdagveyvdnggslvsltsgglsgsrlglkgsedlgggl
00464621   1/1  ----------------------qssvtLyGrvdagveyvdndggggslvrltsgglsgsrlglkgsedlg
00486381   1/1  ---------------aevyaaaqssvtlyGridagveyvdn.gltsgglsgsrlglkgsedLggglkaif


                         -         -         *         -         -         -         -:140
query           SMQVDNNENVGTSTFDNRSVTINMGDAGTFAFGGHGLDSVVGGVDDVMPTAYGETWDIISNTVDNGGVTS
00533281   1/1  aifqlelgfdaddgsgslflreayvgld.gdfGtltlGrq..dtplddatdatdvfyglgls...gvadl
00532781   1/1  ifqlesgfnldng....rqayvgls.gdfGtltlGrqytplydvlgltdpfgaaggdsagllaggl....
00487641   1/1  qlEsgfnldngaggggelflrqayvglkfgdfgtltlG.............rqytpfgdlvaltdpfgaf
00472581   1/1  kaifqlEsgfnldngallgqggrlfgRqayvGlksgdfGtltlG.....rqytplydvl...........
00464621   1/1  gglkaifqlEsgfnldngasggrlfgRqayvgLsgd.fGtltlGrqytplydllaltdpfglgggdsagl
00486381   1/1  qlEsgfnlnngagsggrlftRqayvGlssgdfGtltlG.....rqytplydvlgat............dp


                         +         -         -         -         -         *         -:210
query           TASTLFGAIGSAGSNNMMRYDNTTAVEGLKISASYVPSGTGEVESSVDYGLEYTGYEGLTLGYAMGENNA
00533281   1/1  fgntggdiiglgaggtrgnlnsisy..spdfggltlaasyapggddaggtegddgygaglsyt.aggltl
00532781   1/1  ......gdlgalgggrvdnaikY..spsfgglsfgasysfgevagldfsngdgygaglsYd.ngglslga
00487641   1/1  ggdsgdldnllgtt...rldngvkytspdflglvggltlgasyafgddgvagdldngdgygagltYelgp
00472581   1/1  .gltdpfgayggdpgdldnlgtgradnsvkYtspdffglfggltfgasyafgnddvagsfsngdgygagl
00464621   1/1  lg.........atlgdidnlagslrvdnsvkYtspsf.gGltlgasysfgndsgvagsfsngdgygaglt
00486381   1/1  fgyfggdagdldnlgtgrvdnsvkYrspdlfglfgglsfgasyafgnnagslggntlggvllgddngdgy


                         -         -         -         +         -         -         -:280
query           AGGTSNTDNDTMYVKYAYGPVTVGYQKSEIDATTATDTDEWTAYGVTYAVSDSLSVGYAESTYDAGSSTT
00533281   1/1  gaay..dtgtggaddadawglgasytfgglptlgasy..sdvdgdtdadgyyv.gasyqv.galtlsagy
00532781   1/1  aylyannaaaagaddldayglgasydfggltlgasytrtendgtlalllagllgadaagdavdsdgyelg
00487641   1/1  fglslgaaylqgdldldaaglatlsdddaqayglgasydfggltlgaeytytdndgaaglggaldsdgyy
00472581   1/1  tYdng.glslgaaysqldndngtvgggtaggddadayglgasydfggltlgalyqytkndgagggtlllk
00464621   1/1  Yang.glslgaaylqlnnaagagaddlrayglgasydfggltlgaayqntendgaaggdldsdgyelgaa
00486381   1/1  gagltYdlgdgltlgaaysssddtna........................tttdgnlgaddadayglgas


                         -         *         -         -         -         -         +:350
query           DQENSNLSVSYTQGGMTLAAGFAEEKNRGGLTTAVNDVKGYDISLAFAF---------------------
00533281   1/1  gytdd...dddatayslgadYklsknttlyaeyay.........agddd---------------------
00532781   1/1  asyql.galtlsagyaytdad.gdddanqvslgadYalskrtslyaeya---------------------
00487641   1/1  l.gagYqltpaltlsagyaytdaddlagggpdadrtqvslgadYklskn---------------------
00472581   1/1  dgnandtdgyelgaaYqltpaltlragyaytdakddggagddadatqvs---------------------
00464621   1/1  yqlgpaltlgagyaytdadgsdadatqvslgadYalskrtdlyaeyayl---------------------
00486381   1/1  ydf.ggltlgasytytdnsdadgldlgardtdgyelgaaYqltpaltlr---------------------