[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21236.1


[Show Plain Result]

## Summary of Sequence Search
   1::462
  13::461 2.4e-123 35.6% 0038817 00388171 1/1   artase-like                             
  22::464 3.5e-119 34.2% 0035142 00351421 1/1   artase-like                             
  10::464 1.2e-118 31.7% 0049643 00496431 1/1   artase-like                             
  20::464 6.7e-118 35.0% 0038780 00387801 1/1   artase-like                             
  19::461 1.3e-115 34.0% 0035216 00352161 1/1   artase-like                             
  10::444 2.5e-115 31.7% 0039358 00393581 1/1   artase-like                             
   8::413   2e-109 31.7% 0045086 00450861 1/1   artase-like                             
  19::450 2.2e-107 32.9% 0035831 00358311 1/1   artase-like                             
  26::436   4e-105 31.7% 0037332 00373321 1/1   artase-like                             
   9::459 1.7e-104 31.2% 0042625 00426251 1/1   artase-like                             
   9::412 1.9e-104 31.2% 0037788 00377881 1/1   artase-like                             
   8::457 2.3e-104 31.3% 0043207 00432071 1/1   artase-like                             
   9::409 1.4e-101 30.6% 0039747 00397471 1/1   artase-like                             
   9::441 4.2e-100 31.7% 0044708 00447081 1/1   artase-like                             
   7::424  1.3e-96 31.0% 0036521 00365211 1/1   artase-like                             
   1::462


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVKNKNNMAIWGSRIKKDASTLFQKVGNSIDIDKKLFQEDILGSIAHVEMLFRQKIISFKIKNKIIFGLN
00388171   1/1  ------------Grflygadtlrslenfsifsdkaliralllveiaaalalaelglipeeaaeailaald
00351421   1/1  ---------------------yvnfeissifsdkaliralllveiaaalalaelgllpeeaaeailaald
00496431   1/1  ---------lWggrtsrllerfaiselrsifsdealiralllveialaralaelgllpaeaaeailaald
00387801   1/1  -------------------rryanfeissifsdkaliralllveiaaalalaelglipeeaaeailaald
00352161   1/1  ------------------tgRylenflisifsdkaliralllveialalalaelglipeeaaeailaald
00393581   1/1  ---------lrierdslgevevpadllasaptdrrlanfeisglfseealiralllveiaaalalaelgl
00450861   1/1  -------elriekdslgevevPldlyygrqtqrlleyfsiemasifsdealiralllveiaaalalaelg
00358311   1/1  ------------------dgryadkfllsifsdgaltsnmlavevaaaralaelglipeeaaeailaald
00373321   1/1  -------------------------elssifsdealiralllveiaaalalaelglipeeaaeaimnal.
00426251   1/1  --------sllggrytsr.......alanifsdealiralllveiaaalalaelglipaeaaeailaald
00377881   1/1  --------lriekdslgevlvPadalyggqtl...ralanfeissifsdealiralllveiaaalalael
00432071   1/1  -------evpldgrygaqt.......lrsifsdraliralllveiaaalalaelgllpeeaaeailaald
00397471   1/1  --------llselriesdslgevevPldklyggqtmralen.failgasifsdealiralllveiaaala
00447081   1/1  --------rierdslgevevPldklyggqtlralen.flielasifsdealiralllveiaaalalaelg
00365211   1/1  ------vevpldgrygaqt.......lrsifsdraliralllveialalalaelglipeeaaeailaald


                         -         -         *         -         -         -         -:140
query           KIEKEILKNKFEYNKKYEDIHMNIEKRLFQIIGEEAGYVHTARSRNDQVITDFKMWTTSATKEINKNLDN
00388171   1/1  eieaetlhdvfagtssnedvhevienrliellgdagghvhlgrssnDvvdtalrlalrdaldlllpalle
00351421   1/1  eilegdleglfeieveqeddvtavemnlnevigdagghvhlgrssnDvvdtalrlalrdaldlllpalle
00496431   1/1  eildvdqeglgtienmnledVianveaeliellgdagdkvhlgrssnDvvdtalrlalrdaldlllpall
00387801   1/1  eieaetlhdvfalvvaledihtsiemnlnevigdagghvhlgrssnDvvdtalrlalrdaldlllpalle
00352161   1/1  eieaetlhdvfpldvaqedigtavemnlnevigdagghvhlgrssnDvvdtalrlalrdaldlllpalle
00393581   1/1  lpeeaaeailaaldeieaetlhdvfaldvfqtgsgtssnenvnevienrliellgeaaggkelvhPndhv
00450861   1/1  lipeeaaeailaaldeieaetlhdvfalvvfqtgsgtssnedvnevienrliellggllgellvdpgdhv
00358311   1/1  ldleeiaeielgtg...hdvh.averalkeligdagghvhlgrssnDvvdtalrlalrdaldlllpalle
00373321   1/1  ...evianraleiegeteddviaveralkelvgdagghvhlgrssnDvvdtalrlalrdaldlllpalla
00426251   1/1  eildefdldviqeiegttendviaevialrellgkelvdagghvhlgrssnDvvdtalrlalrdaldlll
00377881   1/1  glipeeaaeailealdeieaetlhdvfalvvfqtgsgedvnmnveevlanralellggllgslelgdpgd
00432071   1/1  qtgadternmnieeviahdvedlhtaleerlgeligdagghvhlgrssnDvvdtalrlalrdaldlllpa
00397471   1/1  laelglipeeaaeailaaldeilaegklgdlfplvvrqtgietstnhdvnavvenrliellgeelgskel
00447081   1/1  lipeeaaeailaaldeilagflagdfpldvrqtgigtetneDvnavienrliellggllglvlvdpgghv
00365211   1/1  dvlag.......gtienedvhdvianlliellgdagghvhlgrssnDvvdtalrlalrdaldlllpalla


                         +         -         -         -         -         *         -:210
query           IIKTILKISEKNIETIMPGFTHLKNAQAVSFAHYLMSYVEMFNRDKKRFTYNLESLSENPLGVAALTGTS
00388171   1/1  lidaLlelaeehkdtvmpGrTHlqdAqPttlGhelaayaaellrdlerLedalkrllvlplggaagtgtg
00351421   1/1  lidaLlelaeehkdtvmpGrTHlqdAqPitlGhelaayaaellrdlerLedalkrllvlplggaagtgtg
00496431   1/1  elidaLlelaeehadtvmpGrTHlqdAqPttlGhelaayaaellrdlerLedalkrllvlplggAvgtga
00387801   1/1  lidaLlelaeehadtvmpGrTHlqdAqPttlGhelaayaaellrdlerLedalkrllvlplggaAlvGTg
00352161   1/1  lidaLlelaeehkdtvmpGrTHlqdAqPttlGhelaayaaellrdlerLedalkrllvlplggaAlvGTg
00393581   1/1  hlgrssnDvvdtalrlalrdaldlllpallelidaLlelaeehadtvmpGrTHlqdAqPttlGhelaaya
00450861   1/1  hlgrssnDvvdtalrlalrdaledlllpallelidaLlelaeehkdtvmpGrTHlqdAqPttlGqelaay
00358311   1/1  lidaLlelaeehadtvmpGrTHlqdAqPttlGhelaayaaellrdlerledalkrllvlplgg.A.vGTg
00373321   1/1  lidaLlelaeehadtvmpGrTHlqdAqPttlGqelaayaaellrdlerledalkrllvlplggAvgtgan
00426251   1/1  pallalidaLaelaeehkdtvmpGrTHlqdAqPttlGhelaayaaellrdlerLedalkrllvlplggAv
00377881   1/1  hvhlgrssnDvvdtalrlalrdaledlllpallelidaLaelaeehkdtvmlGrTHlqdAqPttlGqela
00432071   1/1  llelidaLlelaeehkdtvmpGrTHlqdAqPttlGhelaayaaellrdlerledalkrllvlplggAvgt
00397471   1/1  vhpgdhvhlgrssnDvvdtalrlalrdaldlllpallelidaLaelaeehadtvmpGrTHlqdAqPttlG
00447081   1/1  hlgrssnDvvdtalrlalrdaledlllpallalidaLaelaeehadtvmpGrTHlqdAqPttlGhelaay
00365211   1/1  lidaLlelaeehadtvmlGrTHlqdAqPttlGqelaayaaellrdlerledalkrllalplGAvGTgana


                         -         -         -         +         -         -         -:280
query           FNIDRNFTSKKLGFKRPTNNSIDTVADRDFVLDFLYSASVCSMHISRIAEELIIWNSDGFNLITLSDKVV
00388171   1/1  lnidreflaellgldllaensldavsdrdflaellsalallavslskiaeDlrllssgelgeielpdagq
00351421   1/1  lnidreflaellgldllaensldavsdrdflaellsalallavslskiaeDlrllssgelgeielpdagq
00496431   1/1  nlpidrerlaellgldlvaensldavsdrdflaellsalallavslskiaeDlrllssgelgeielpdag
00387801   1/1  anldreflaellgldfvtensldavsdrdflaellsalallavslskiaeDlrllssgelgevelpdagq
00352161   1/1  anldrevaaellgflglapnsldavsdrdflaellsalallavslskiaeDlrllssgefgeleepdagq
00393581   1/1  aellrdlerLedalkrllvlplgggAv.GTglnldpefallvaellaellgldfvtaensldavsdrdal
00450861   1/1  aaellrdlerLedalkrlnllplgggA.vGTganldpefallvaellaellgldfvpasnqieavsdrdf
00358311   1/1  anldrelaelvaelLgld..aensldavsdrdflaellsalallavslskiaeDlrllssgefgelgell
00373321   1/1  llplvrelvaellgldf..ensldavsdrdalaellsalallavslskiaeDlrllssgefgelgellda
00426251   1/1  gtganllpafpidrerlaellgld...ensldavsdrdflaellsalallavslskiaeDlrllssgefg
00377881   1/1  ayaaellrdlerledalkrllvlplggtA.vGTglnldpevdelvaellgfltglglvlaensldavsdr
00432071   1/1  gnalpidalavrerlaellgld...ensldavsdrdflaellsalallavslskiaeDlrllssgefgel
00397471   1/1  qelaayaaellrdlerLedalkrlnllplgggAv.GTganldpefalavaellaellgldfvtaenslda
00447081   1/1  aaellrdlerLedalkrlnllplgggA.vGTganldpdfalavaellaellgldfvtaensldavsdrdf
00365211   1/1  gtgfpldrealaellgld.v.ensldavsdrdalaellsalallavslskianDlrllssgefgel...p


                         -         *         -         -         -         -         +:350
query           TGSSIMPQKKNPDLLEYLRGKTGTVYGNLFSMLTILKGLPISYFKDLQDDKEILFKSNEILNNSIAILNE
00388171   1/1  tGSSiMPqKvNPvllElvrglagrvignlvalllalkglplrlnrdlqeekvalldsvvllaaallllag
00351421   1/1  tGSSiMPqKvNPvllElvrglagrvignlvalllalknlplrlnrdlqeskevlldsvvllaaallllan
00496431   1/1  qtGSSiMPhKvNPvvaElvrglagrvignlvalllalkglplrlnrdlqlskenlldsllllllalrlla
00387801   1/1  tGSSiMPhKvNPvllElvrglagrvignlvalllalkglplelnrdlqvekenlldsllllllalrllak
00352161   1/1  tGSSiMPhKvNPvllElvrglagrvignlvalllalknlplelnrdlqvekrnlldsllllllalrllan
00393581   1/1  aellsalallavslskianDlrllssgelgeleEilldagqtGSSiMPhKvNPvllElvrglagrvigll
00450861   1/1  laellsalallavslskianDlrllssgefggveellldagqtGSSiMPhKvNPvilElvrglagrvigl
00358311   1/1  dagqtGSSiMPhKvNPvllElvrglagrvigllaal...laglplwlerdlqeskvernllpdaflllda
00373321   1/1  gqtGSSiMPhKvNPvllElvrglagrvigllaal...laglplwlerdlqesviernllpdafllldaal
00426251   1/1  elgelldagqtGSSiMPhKvNPvllElvrglagrvigllaal...laglplwlerdlqesviernllpda
00377881   1/1  dalaellsalallavslskianDlrllssgefgeleeilldagqtGSSiMPhKvNPviaElvrglagrvi
00432071   1/1  gelflpgqtGSSiMPhKvNPvllElvrglagrvigllaal...laglplwlerdlqesviernllpdafl
00397471   1/1  vsdrdalaellsalallavslskianDlrllssgefgeleEilldagqtGSSiMPhKvNPvilElvrgla
00447081   1/1  laellsalallavslskianDlrllssgefggveellldagqtGSSiMPhKvNPvllElvrglagrvigl
00365211   1/1  agqtGSSiMPhKvNPvllElvrglagrvigllaal...lkalplwlerdlqesviernllpdafllldaa


                         -         -         -         -         *         -         -:420
query           VLKNLKPNKQQMLDLANSGYITATDLADYLVKNHSMPFRKAYQTTASIVNYAEKKKKKLNELNIDELKKI
00388171   1/1  lleglevnpermrenld.glvlatalalalvrk.glpfreayeivgelaklaleegkdlrellledlivl
00351421   1/1  lleglevneermrenld.glvlatalalalvrk.glpfreayeivgelarlaleegkdlrellledlivl
00496431   1/1  klleglevneermrenldnglilatalalalvrk.glpfreayeivgelaklaleegkdllellledliv
00387801   1/1  lleglevneermrenld.glvlatalalalvrk.glpfreayeivgelarlaleegkdlrellledlivl
00352161   1/1  lleglevnpermrenld.glvlatalalalvrk.glpfreayeivgelaklaleegkdlrellledlivl
00393581   1/1  aalltalkalplernldlsvvernllpslfllldaalslltglleglevneermrenldaslglvtalad
00450861   1/1  lvalllalkalplernldlsvvernllpslfllldaalalllklleglevneermrenldasl-------
00358311   1/1  alslltglleglevneermrenldaslglvtaedlalalvrk.glpfreayeivgelarlaleegkdlle
00373321   1/1  slltglleglevneermrenldaslglvtaedlalalvrk.glprreayeivgeiakealeegltlrell
00426251   1/1  fllldaalslltgvleglevneermrenldaslglvtaedlalaLvk..gigfeeAheivkelvrlalee
00377881   1/1  gllvall..lkalplrlerdlqesviernllpdafllldaalslltglleglevneermren--------
00432071   1/1  lldaalslltgvleglevnpermrenldaslglvtaedlalalvk..gigfeeAheivgelarlaleegk
00397471   1/1  grvignlvalllalkalplelnrdlsvsernllpsifllldaalllltnlleglevnee-----------
00447081   1/1  laalltalkalplernldlsvvernllpsldllldaalllltnlleglevneermrenldaslglvtala
00365211   1/1  lslllklleglevneermrenldaslglvtaedlalalvrk.glprreayeivgelarealeegltllel


                         -         -         +         -         -         -         -:490
query           EPRLTIEVLKIFNVKNSVNSKKSYGGTSFDNIKKMIMKYKKT----------------------------
00388171   1/1  lllteeeldelldpenyvgaadsiggtaleeveellelakk-----------------------------
00351421   1/1  lllteeeldelldpenylgradsiggtaleeveellelakklle--------------------------
00496431   1/1  llllseeeldelldpenyvgaadslggtaleeveellellkell--------------------------
00387801   1/1  lllteeeldelldpenyvgladslggtaleeveellellkklls--------------------------
00352161   1/1  lllteeeldelldpenyvgaadsiggtaleeveellellkk-----------------------------
00393581   1/1  ......gigrreAheivge....a----------------------------------------------
00450861   1/1  ----------------------------------------------------------------------
00358311   1/1  llledlivllllteeeldelldpenyvgla----------------------------------------
00373321   1/1  ledlevlgllteeeld------------------------------------------------------
00426251   1/1  gkdlrellledlivllllteeeldelldpeny.......-------------------------------
00377881   1/1  ----------------------------------------------------------------------
00432071   1/1  dlrellledlivllllteeeldelldpenyvgladsl---------------------------------
00397471   1/1  ----------------------------------------------------------------------
00447081   1/1  d......gigrreAheivge.-------------------------------------------------
00365211   1/1  llel------------------------------------------------------------------