[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21245.1


[Show Plain Result]

## Summary of Sequence Search
   1::299
  98::178  8.2e-11 27.5% 0052545 00525451 1/1   like                                    
   1::299


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKTSTTNILAKIFKKTPEKKVKKKTKAKVAKKPTLPKAKVVKKKIPVKKTKTIKATPTKIKKNLKTVSK
00525451   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KAVPEKVEIKTDNLRISKSNEVKPEIKKVKKQETEKREYKVKDYVVYPKHGVGQITEFKKINIGGIDVET
00525451   1/1  ---------------------------sedallldllelkvGdyvVhpdhGvGrflgletlevggvlley


                         +         -         -         -         -         *         -:210
query           YVLKFEKDKANGMVPVNKQSHLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAE
00525451   1/1  lvley.adgdklyvPvdnldlvsryvgadgeevkldkL--------------------------------


                         -         -         -         +         -         -         -:280
query           VVRDLNKGDDLMVDQSYSERQLFEKAYERILSEFQIVMGISLEDTQKKLDKALKRNLEGQAKAVAAPTKI
00525451   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KEPITESDTDSEPITDTED---------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------