[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21331.1


[Show Plain Result]

## Summary of Sequence Search
   1::203
   1::201  2.3e-60 41.4% 0044706 00447061 1/1   bination protein RecR                   
   1::203


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQNINEIEELIKLISKLPGLGPKSAKRIVLKLINNRDELVKPMANTLAQVYKNVIRCQSCGTLKSNSLGC
00447061   1/1  llllelleeliealsklPgigpksaqrlalhllkldeelllkladalleakekiklCelCgnlteeel.C


                         -         -         *         -         -         -         -:140
query           NNCENSKEKYNKICVVEDIADQWSIENSNIYKGYFHILGGTISSAGQRKEDLLINSLVERVSRENIEEVI
00447061   1/1  eiCsdesRdssllcvveelkdvlaleetglykGlYhvlggllspldgigpedlnldellerl..gevkev


                         +         -         -         -         -         *         -:210
query           LATSATVEGQTTAYYIEDSLKKTSTKVTKLAQGLPVGGEIESLDDGTLYSAFKNRTGIKTNSD-------
00447061   1/1  ilalnatleGeatalyiaellkdlgvkvtrlalGlPvGgeleyvdeltlaralegrrelee---------