[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21392.1


[Show Plain Result]

## Summary of Sequence Search
   1::312
   1::309  1.6e-62 31.2% 0052116 00521161 1/1   )-binding Rossmann-fold domains         
   1::311  1.8e-61 26.5% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
   7::307  3.3e-61 27.5% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
   7::309  2.2e-58 34.4% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
   6::310  1.5e-57 30.4% 0051996 00519961 1/1   )-binding Rossmann-fold domains         
   1::309  6.6e-57 29.7% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
   6::313  9.2e-57 33.4% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
   6::310  3.6e-55 28.7% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
   1::309  9.1e-50 28.0% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
   6::309  9.4e-50 27.1% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
   7::308    1e-47 27.9% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
   6::309  1.3e-46 26.6% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
   1::308  9.2e-46 24.9% 0046574 00465741 1/1   )-binding Rossmann-fold domains         
   4::314  1.5e-45 26.4% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
   6::308  1.9e-45 26.2% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
   4::308    2e-44 28.5% 0049198 00491981 1/1   )-binding Rossmann-fold domains         
   5::308  3.2e-44 25.9% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
   4::308  5.5e-43 25.7% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
   4::308  1.5e-42 26.5% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
   4::313  1.5e-42 24.1% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
   5::308  8.2e-42 26.0% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
   4::308  4.9e-40 25.4% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
   1::309  9.7e-36 26.3% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
   1::304  1.6e-31 29.7% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
   1::304  2.3e-28 29.0% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
   1::247  1.2e-25 24.0% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
   4::247  3.3e-24 27.4% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
   4::263  8.9e-22 22.9% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
   4::250    4e-21 20.7% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
   1::247  6.1e-21 22.5% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
   4::252  1.3e-17 21.1% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
   6::242  1.3e-15 24.6% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
   1::312  4.6e-13 21.6% 0048270 00482701 1/1   )-binding Rossmann-fold domains         
   2::145  7.3e-13 23.4% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
   1::123  9.9e-13 23.7% 0036007 00360071 1/1   )-binding Rossmann-fold domains         
   5::309  6.3e-12 21.9% 0044853 00448531 1/1   )-binding Rossmann-fold domains         
   5::125  9.2e-12 26.1% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
   1::263  2.5e-11 19.1% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
   4::249  9.3e-11 17.6% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   1::123  5.2e-09 23.7% 0045645 00456451 1/1   )-binding Rossmann-fold domains         
   3::135    5e-08 21.1% 0045621 00456211 1/1   )-binding Rossmann-fold domains         
   6::165  7.4e-08 28.0% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
   3::121  1.6e-07 26.3% 0035405 00354051 1/1   )-binding Rossmann-fold domains         
   4::230  6.1e-07 19.6% 0042131 00421311 1/1   )-binding Rossmann-fold domains         
   1::230  7.1e-07 21.3% 0048286 00482861 1/1   )-binding Rossmann-fold domains         
   5::227  7.9e-06 21.4% 0046801 00468011 1/1   )-binding Rossmann-fold domains         
   1::147  9.4e-06 24.8% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
   6::146  1.5e-05 21.5% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
   1::230  1.7e-05 19.0% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
   1::231  2.2e-05 20.4% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
   1::231  5.1e-05 21.3% 0038770 00387701 1/1   )-binding Rossmann-fold domains         
   5::249  5.8e-05 17.3% 0049845 00498451 1/1   )-binding Rossmann-fold domains         
   1::237  8.3e-05 21.5% 0051109 00511091 1/1   )-binding Rossmann-fold domains         
   4::171  0.00059 20.9% 0051355 00513551 1/1   )-binding Rossmann-fold domains         
   1::312


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MINRNSRIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQIKVIKFLKKKKPDFIFIAAAKVGG
00521161   1/1  MslllllllllmlkgmkilVTGaaGfiGshlvrrLlerG.yevvaldrspekleelldpgvefvegDltd
00464721   1/1  M...gktvlvtGatGfiGsalaraLlarGaveVvaldrspeDltdpeslaaalagvrvdvvihlAgivsa
00371281   1/1  ------kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgaklgpgvefvegDltdpesleaaleeve
00462911   1/1  ------skkvLvTGatGfiGsalvrrLlerGy.eVialdrlssgsneekleellkelellgpgvefvkgD
00519961   1/1  -----MkvLvtGatGfiGshlvrrLlerghleVvgldrlssgleellelpgvefvegDltdpealeeala
00383241   1/1  M...gkrvLvTGgtGfiGshlvraLlerpGh.evvvldrlpsgadallellalltlllslleklllllel
00519251   1/1  -----kkkilvtGatGfiGsalaraLlerg.yevialdrspekleellkllvefvkgDltdpesleealk
00419991   1/1  -----kkvLvTGgtGfiGshlaraLlerGa.evvvldrlsegaeellaelealgprvefvkgDltdpeal
00400431   1/1  M...gkkvLvTGgtGfiGsalvraLlerGa.evvvldrdpegaaellallealggprvefvagDltdpea
00498641   1/1  -----krvLvTGgtGfiGsalaraLlerG.aevvvldrseekleelleeleallggrvefvegDltdpea
00490261   1/1  ------ktvlvTGatGgiGsalaraLlarGa.eVvaldrspeklealaaeleallpllllfellglldel
00433371   1/1  -----ktvLVTGatGfiGsalaraLlerGyrVvaldrdpekleellaelealgggvefvegDltdpesla
00465741   1/1  M...gktvlvTGatGgiGsalaraLlarGa.eVvlldrspsslllllekleelaaelealgggvefvqgD
00495191   1/1  ---r.ktvlvTGatGgiGsalaraLlarGa.eVvlldrlssglspekleellaellealgggvefvqgDl
00514911   1/1  -----SKtvlvTGatGgiGsalaraLlerGa.eVvlldrspekleellaeleallgggvefvqgDltdpe
00491981   1/1  ---lnpsemkgkrvlvtGgtGfiGsnlaelLlergy.evvgldrsepglnslldllllaeniafvkgDls
00460341   1/1  ----gktvlvTGatGgiGsalaraLlarpGae.VvaldrltsagspeklealaaelgvefvqgDltdpes
00491171   1/1  ---k..tvlvTGatGgiGsalaraLlallllslaGa.evvaldrspseealealaellalggvefvqgDl
00468971   1/1  ---k..tvlvTGatGgiGsalaraLlarpGa.eVvaldrlsspeklealaallgalgvefvqgDltdpes
00493571   1/1  ---llsllsslldllslkgktvlvTGatGgiGsalaraLlarGa.eVvlldrspekleelaaelealggs
00482931   1/1  ----nktvlvTGatGgiGsalaraLlarGa.eVvlldrlssgaseekleelaaelraaggpgvefvqgDl
00507211   1/1  ---ldmmslmgktvlvTGatGgiGsalaraLlarGa.eVvlldrspekleelaaelealggvefvqgDlt
00511831   1/1  llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldrspekleelaallealggdpgvelvvgD
00430421   1/1  M..kgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelleellglgvevvegDltdpes
00430411   1/1  M..sgkkvlvtGAtGfiGshlaraLleaG.hevvalvRspekaalalalelleelaapgvevvegDltdp
00527221   1/1  llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvRrpekleelaaegvevvvgDltdpe
00516961   1/1  ---kgkrvlvtGAtGfiGshlvrrLlaeghvsevvalvrrpskllpgvevvvgDltdp..laealag..v
00532871   1/1  ---lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvrspekleelgggvevvvgDltdpdslaaala
00486141   1/1  ---kgkvvlvtGgsggiGsalaralaaeGakvvlvdrseealaegggalavaaDvtdeeavealveaave
00519911   1/1  lllllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVtalvRrpekleelaaegvevvvgDltd
00385591   1/1  ---egkvvLVtGgsggiGraiaralaaaGa.rVvvvdrseealgggvlavaaDvtdeeavaalvaaavel
00471781   1/1  -----mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdpsklaallglgvevvvgDltdpaslaaal
00482701   1/1  M.....kilvtGanGqlGsalvrllaelgdvvvlalgrdllllDltdpeavrellaelkpdvvinaaAyt
00354771   1/1  -MlkgmkvlVtGAaGgiGsalalrlaarglagldllvevvlldrsealealegvaldlsdgalavlldlt
00360071   1/1  lellllialenllllllllllellllsllkpmkVlVtGAaGfiGshlalrLlsgglagldqlvevvlldr
00448531   1/1  ----lmkilvtGaaGqlGsalvrllleagle.vvaldfvelDitdaeavaellaevkpdvvinaAA.yta
00502281   1/1  ----mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsagkllnepgvevvegdltdpddlekalk.
00354711   1/1  MslkgkvvlvTGasggiGralaralaaaGar.VvlldrseekleelaaelggrvlavalDvtdeesveaa
00527441   1/1  ---amdlgllsgkvvlvTGasggiGralaralaarGarvVvlldrsglleekleelaaelealggrvlfv
00456451   1/1  mienlllllelllelellkslkkpmkvlvtGAaGfiGshlallLasgglagldqvvelvlldiveslgkl
00456211   1/1  --lkplkvlvtGAaGqiGsalalllalggladldlevelvlldivealdalkgvaldlsdaalpllldvi
00481861   1/1  -----kkvlvtGAsGgiGsalalllaarga.evvlldrspeklegvaldlsdlgvevvvadltdpeslae
00354051   1/1  --lkpmkvlvtGAaGfiGyalalllaaggladldllvelvlldiveeyaleklkgvaldlsdaaapllld
00421311   1/1  ---kgkvalvTGassgiGraiAralaaeGa.rVvltdrnseekleelaaeleallggralavalDvtdea
00482861   1/1  m.lkgkvvlvTGassGiGlalaralaarGasrVvlldrneekleelaaelealggrvlfvqlDvtdeesv
00468011   1/1  ----gkvalvTGassgiGraiaralaaaGa.rVvlldrneekvqlDvtdeesvealveavleefggrldi
00496861   1/1  AasilllgltsylallevlkikegkkVlvtGAtGgiGlavvrlllkrGy.kViaidrseekleklkelga
00387841   1/1  -----kkvlvtGAsGgiGsalalllakega.evvlvdrdeekalealagelldlgggalvlvadvtdlea
00424291   1/1  mmlslkgkvvlvtGasggiGralaralaaaGa.rVvlldrseekleelaaelgrvlavvlDvtdeesvea
00361941   1/1  mdlkgkvalvtGasggiGraiaralaaaGa.rVvlldrneekleelaaelgrvlavvlDvtdeesveaav
00387701   1/1  mmdlkgkvalvTGasggiGlaiaralaaeGa.rVvlldrneekleelaaelggrvlavalDvtdeesvea
00498451   1/1  ----gkvalvTGassgiGralaralaarGar.VvlldrseeggrvlavaaDvtdeesvealvaaalefgr
00511091   1/1  sslsllldmlslkgkvalvTGasggiGralaralaarGa.rVvlldrseekleelaaelealgggrvlvv
00513551   1/1  ---lkgkvalvTGasggiGlaiaralaeeGdla.kVvlldrneekleelaaelggrvlfvqlDvtdeesv


                         -         -         *         -         -         -         -:140
query           IYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAI
00521161   1/1  pealeeale..gvdaVihlAalssvgeseedppleflevNvlgtlnlleaarkagvkrfvfaSSsavygd
00464721   1/1  vdlseedpeevldvNvlgtlnlleaarkagvkrivfvSSiavyggpgglpidEddllllplnplsapYga
00371281   1/1  kfggvdvvihlAaissvdes...dpeelldvNvlgtlnlleaarkagv.rfvytSSaavyggppglpidE
00462911   1/1  ltdpesleealkgvkpdvvihlAaivhv.dlseedpeetidvNvlgtlnlleaarkagvksggrfvfiSS
00519961   1/1  k.gvdaVihlAalvsv.deseedplefievnvlgtlnlleaarkag.krfvfaSsaavygdpeglpidEd
00383241   1/1  lgprvefvegDltdpealaaalaefggvdvVihlAalvhv.dlseedpeevldvNvlgtlnlleaarkag
00519251   1/1  g..vdvvihlAaivgv.dlseedpeetidvNvlgtlnlleaarkagv.rfvfiSSsavygdpkkgpidEd
00419991   1/1  aalleeigvdaVihlAaissv.dlseedpeevldvNvlgtlnlleaarkagvkprfvfiSSaavyggspg
00400431   1/1  leaala..gvdaVvhlAalshv.dlseedpeevlevNvlgtlnlleaarkagv.rfvfiSSaavyggspl
00498641   1/1  leaaleevgvdvvihlAgissv.dlseedpeevldvNvlgtlnlleaarkagvgrivfiSSaavyggsee
00490261   1/1  lggrvefvegDltdpesleaaleevgvDvvvhnAgissvgpseltledpeevldvNvlgtlnlleaalpa
00433371   1/1  aalagvrpdvvvhlAalssv.dlseedpeevldvNvlgtlnlleaareagvvgrivfvSSaavyggppgl
00465741   1/1  ltdpeslaaaleevgvdvvihnAgi.plvdlseedpeevldvNvlgtlnlleaalpagvgrivfvSSiav
00495191   1/1  tdpeslaaalagvrldvvvhnAgivgv.dlseedpeevldvNvlgtlnlleaalpagvksggrivniSSi
00514911   1/1  slaaaleevgvdvvvhnAgivgv.dlseedpeevldvNvlgtlnlleaalpagvgrivfvSSiavyggll
00491981   1/1  dkealkraladvkpdvVihlAavsgp.rvsaadpeavydtnvlgtlnlleaakkagpvkrlvfvStagvy
00460341   1/1  laaalagvriDvvihnAgivsv.dlseedpeevldvNvlgtlnlleaalpagvkrggggglslrivfiSs
00491171   1/1  tdpeslaaala..gvdvvvhnAgivsv.dlseedpeevldvNvlgtlnlleaarkagvgrivfvSSigvy
00468971   1/1  laaalagvridvvihnAgiv.lvdlseedpeevldvNvlgtlnlleaalpagvkrggggglslrivfvSS
00493571   1/1  lllggvefvqgDltdpesleaala..gvdvvvhnAgivgv.dlseedpeevldvNvlgtlnlleaalpag
00482931   1/1  tdpeslaaalagvrldvvvhnAgissv.dlseedpeevldvNvlgtlnlleaalpagvkrggggrivniS
00507211   1/1  dpeslaaalagvriDvvvhnAgi.plvdlseedpeevldvNvlgtlnlleaarkagtvgrivnvSSagvy
00511831   1/1  ltdpesleaale..gvdvvihlAgiasvg....edpeelidvNvlgtlnlleaarkagsvkrivfvSSia
00430421   1/1  laealk..gvDvVihlagl............evidvnvlgtlnlleaakeagnvkrfvfvSsagvyg...
00430411   1/1  eslaealk..gvdvVihlag................dvnvlgtlnlleaakkagvkrfvfvSsagvyg..
00527221   1/1  slaealk..gvdvvinaagttrfg....edleeflavnvdgtlnlaeaakkagvkrfvlvSslgalg...
00516961   1/1  dvvihlagvvrf...sagdpeaflavnvdgtlnlleaaraagvkrfvlvSslgaygd.............
00532871   1/1  ..gvdavvhlagivgvgalllllllksllelseedpeevldvnvlgtlnlleaakaagvkrivlvSslga
00486141   1/1  afggldvlvnnagillplgplldlsledwdrvldvnllgtflllraalpllvkggrivnisSvagyg...
00519911   1/1  peslaaalk..gvdvvinaagitrvg....edleefldvnvdgtlnlldaakkagvkrfvlvSslgalg.
00385591   1/1  lefggldvlvnnagilavgeplldlsledwdrvldvnllgtflllraalplmvkggrivnissvaglg..
00471781   1/1  a..gvdaVihlag........padpldllevnvdgtrnlleaakaagvkrlvlvssagaygdepgppl..
00482701   1/1  a.vdkaesdpelayavNvlgplnLaeaaaelgar.lvhiSTdyVFdgtkglpyteddppnP.....lnvY
00354771   1/1  dtddlaealk..gadvvvhlagv...prkpgedrddllavnvlgtralleaarkagvgrivvvssgnpvd
00360071   1/1  leslekleglaldlsdaatfllgdvsdtadleealk..gadvvvhlAgvp...-----------------
00448531   1/1  vdraesepelalavNvlgtavlaeaarelgar.lvhiSTDyVFdglkegpyteddplaP.....lsvYGa
00502281   1/1  .gvDvvihaag....tsrvdeslkdalgtnvigtssalrllnlleaakeagvkrf---------------
00354711   1/1  veavleefggldvlvnnAgillvlllllgpledlsledwervldvNvlgtflltraalplmrkag.griv
00527441   1/1  aaDvtdpesvealvaeileefgldvlvnnAgillvgpledlsledfervldvnvlgtfnllraalplgvg
00456451   1/1  egvaldlsdaafpllgdvtvgtdlyeafk..gadvvvhlAgvp...rkpgmdr-----------------
00456211   1/1  dtddlyealkg..advvvhtAgvp...rkpgmtrldllevNvkitknlleaiakygpkavvvlvv-----
00481861   1/1  alkg..advvviaagip...rkpgedrldlldvnvlgvknlleaaakagvgrivlvssnpvdgl......
00354051   1/1  ltvttdlyealkg..advvvilAgvprkpg...mtrldllevnakifkell-------------------
00421311   1/1  laeeleelelllllllesvealveaalerfgrldilvnnAgialvgallglllllllllkplldlsledw
00482861   1/1  ealveevleefgrldilvnnAGil.gpledlsledfllervldvNvlgtflltraalplllkggrivnvs
00468011   1/1  lvnnAGialpgpll....ervldvNllgtflltraalpllrkrgggrivnisSlavygalldlpllelll
00496861   1/1  dvvldvtdveellkallklggvdvvihtag.apvtelslsllkqllrvnvlgtlnllrallpllvklgvk
00387841   1/1  vedlvealggadvvvnnagvp...rkpgeerldllevnvlgtknlaealkkagpgrivvvsspagllglp
00424291   1/1  aveelggldvlvnnagiallgplldlsledfervldvnllgtflltraalplmrkaglggrivnissvag
00361941   1/1  eelggldvlvnnagialpgplldlsledfervldvnllgtflltraalplmrkrglggrivnissvagll
00387701   1/1  lveavleefgrldilvnnAgialp.gplldlsledfervldvnllgtflltraalplmrkrg.grivnis
00498451   1/1  ldilvnnAgillpllllgplldlsledwdrvldvnllgtflltraalplmrkrgaasgggggrivnisSv
00511091   1/1  aaDvtdeesvealveeileefgrldilvnnAgillpdgpledsledfervldvNvlgtflltraalplrk
00513551   1/1  ealveeileefgrlgldilvnnAgillplgplldlsledfervldvNllgtflltkaalplmkkrgalss


                         +         -         -         -         -         *         -:210
query           AKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPALIKKIHKLKLSKKNTVILWGNGKAK
00521161   1/1  peglpidEdtlldvdleplnplspYgasKlaaellarayareygldvvilrpfnvyGpgdrpngvtgsvi
00464721   1/1  sKaaaelllralarelglrvtilrpgnvygpggrpllglsgvlprlirlallaalaglpvltvlgdgdqv
00371281   1/1  dtpln.....plspYgasKaaaellvralareyglrvvilrpgnvygpggrpdgltssviplllrlala.
00462911   1/1  savyggppglpidEddpln.....plspYgasKaaaelllrayakeyglrvvilrpgnvyGpgggpdgvt
00519961   1/1  dwldveltplnplspYgasKlaaelllrayareygldvvilrpfnvyGpglspllgeshvlggliplfir
00383241   1/1  vkrfvfaSSaavyggnplllllddelpidEddpln.....plspYgasKaaaeklvrayareyglpvvil
00519251   1/1  dllllnplnplspYgasKlaaekllrayakeyglrvtilrpgnvyGpgqrpng..gsviplfirlilk..
00419991   1/1  qpldesllldvdllpllaitEdtplnplspYaasKaaaealarayareyglrvvilrpgnvyGpggrp.g
00400431   1/1  lllllglllldglpidEdtpld.....plspYgasKaaaellvrayareyglrvvilrpgnvyGpggrpe
00498641   1/1  gpidEddpld....pplspYgasKaaaellaralarelygirvvilrpgnvygpglrpllgedplgalgg
00490261   1/1  gvggrivfvSSiavygdpd.gpidEddlllvllllllllltplpplsaYgasKaaaelllralarelgir
00433371   1/1  pidEdtpln.....plspYgasKaaaellaralareyglrvvilrpgnvygpggrpdgvtsnliplllrl
00465741   1/1  ygdpdglpidEgdpgl....pplspYgasKaaaelllralaregsgirvtilrpgnvygpglspllgell
00495191   1/1  avygdpeglpidEdtplpp.....lspYgasKaaaeallralarelgirvtilrpgnvygpggrpllvt.
00514911   1/1  llppglpidEddp.....lnplspYgasKaaaelllralareapygirvtilrpgnvygpllsgllgell
00491981   1/1  gdvsagipidEddpllp.....tspyglsKlaaEqilrslarryldkplnrqhglpvvvlrpgnvyGpgd
00460341   1/1  iavygglpgqsgpitEdd.....pldplspYgasKaaaeallralarelgirvtilrpgnvygpgggp..
00491171   1/1  ggpgglpidEdtplppls.....pYgasKaaaeallralarelglrvtilrpgnvygpgggp....gnll
00468971   1/1  iavyggpggllevllesllgpldedd.....plnplspYgasKaaaeallralarelgirvtilrpgnvy
00493571   1/1  vgrivniSSigvyggpggapidEdd.....plnplspYgasKaaaeallralarelgirvtivrpgnvyg
00482931   1/1  Sigvyg.dpggpidEddpl.....nplsaYgasKaaaeallralarelgirvtilrpgnvygpggrpgl.
00507211   1/1  gdpglggpidEddpldp.....lspYgasKaaaeallralarelaptglllelgirvtivrpgnvygpgl
00511831   1/1  avygdplllpglpidEdtwldvdllaalllllelplpplspYgasKaaaealaralarelapglrvvilr
00430421   1/1  ..d..edtpln.....plspygasKaaaekllra....sglpvtilrpgnvygpgl......sgliplll
00430411   1/1  .....dedtplp.....plspygasKaaaeallral....glpvtivrpgnvygpglsg.......ipll
00527221   1/1  ...............pspspyaasKaaaeallral....glprvtivrpglvlg.......plgeplpge
00516961   1/1  .....plspyarsKaaaeallral....glprvtilrpglvygprd.......gfllallll........
00532871   1/1  ygg......dedtp.....lpplspygasKaaaeallra....sglrvtilrpglvlgpllsg.......
00486141   1/1  .............plpglaaYaasKaavegltrslalelapllkgirvnavapglvdtpllra.......
00519911   1/1  .................pspspyaasKaaaeallral....gldlvtivrpglvlgplls......pllg
00385591   1/1  ..............glpglaaYgasKaavegltrslalelapllkgirvnavapgnvdtpmlrg......
00471781   1/1  ..........plspyaaskaaaeellra....sgldytilrpgalfgpg.....................
00482701   1/1  GrsKlagEqavlaa....gpkalilRtswvyg......elgknfvktmlrla.......aerdelsvvgd
00354771   1/1  ilalv-----------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00448531   1/1  sKlagellvlallpty....lilRtswvygpggnf...........vklmlrlalegkelpvvgd...qi
00502281   1/1  ----------------------------------------------------------------------
00354711   1/1  nisSvaglg................glpglaaYaasKaalegltrslarelapgirvnavapglvdt...
00527441   1/1  rivniSSiagvlgsp................gqsaYaasKaalealtrslaae.girvnavrpglvatp.
00456451   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00481861   1/1  ...............ayaaskaale---------------------------------------------
00354051   1/1  ----------------------------------------------------------------------
00421311   1/1  drvldvnllgtflltraalplmrkrsaessggggrivnisSvagll................glpglaaY
00482861   1/1  Svagllglpglddllleelllsdllllllldlllelldlllplledtplgp.....laaYaasKaalegl
00468011   1/1  llllldlledvaglrglplglaaYaasKaalegltrslalelaprgirvnavaPglvdTpllrgllalee
00496861   1/1  rivyiss---------------------------------------------------------------
00387841   1/1  ......----------------------------------------------------------------
00424291   1/1  llglpgla................aYaasKaalegltrslalelaprgirvnavapglvltpllralll.
00361941   1/1  ................glpglaaYaasKaalegltrslalelaprgirvnavapglvatpllralll...
00387701   1/1  Svagll................glpglaaYaasKaalegltralalelaprglgirvnavapglvatpll
00498451   1/1  agl................lglpglaaYaasKaalegltrslalelaprgirvnavapglvdtpllagll
00511091   1/1  rglgrivnisSiagllglpg................qaaYaasKaalealtrslalelallprgirvnav
00513551   1/1  gellslgggrivnisSiagllglpglgllel---------------------------------------


                         -         -         -         +         -         -         -:280
query           REVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNKKIKIKYDKTKPNGSPRKVM
00521161   1/1  plliraal....gkgepltvfgdgdqvrdfihvdDvaealllaleapa.ggvynigggepvsvrelaell
00464721   1/1  rdfihvddvaraillaleapaaglddlllvlggvynlgggepvsvrelaealaeal..glpipivpvplr
00371281   1/1  ....gepltlvlgdgdqlrdfihvdDvadaillaledpa.ggiynvgggepvsvlelaealaell..grp
00462911   1/1  skviplliraa.....lkgkplpilgdgdqtrdfihvdDvaeaillalekp.ageiynigggepvsvrel
00519961   1/1  aalggkp.ltvfgdgdqvrdfihvdDvaealllalekpeslaaggvynlgggenpvsvrelaellakal.
00383241   1/1  rpgnvyGpggspllgeshvlptlllplilqvalggatasviprflraalag.gplpvfgddygtpdgdqt
00519251   1/1  ...gkpltifgdgdqtrdfihvdDvaeaillalekpksgi.ynigsgepvsilelaeliakll..glkik
00419991   1/1  lpsgvlpllirqilraalglggpltvfgdgdqvrdfihvdDvaeaillaleklagavggvynigggleep
00400431   1/1  ....sliplllraalk.....ggpltvfgdgdqvrdfvhvdDvadaillalekpaaggvynlgggepvsv
00498641   1/1  llplllraalg....kgepltvlgldyptgdgdqvrdfihvdDvaeavlllledlasgatggvynvggge
00490261   1/1  vtilrpgnvygpglrplgligellllldpsgvvggllprllraalag.eplpvlgdgdqvrdfihvdDva
00433371   1/1  alggep.....ltvlgdgdqvrdfvhvdDvaeavlllleapa.ggvynlgggeevsvlelaealaell..
00465741   1/1  lgvpdsllplflraalgglgplpvlgslydtlDgdqvrdfihvddvaraillalenpaaggegrvynlgg
00495191   1/1  sllplflrla....laggplplvlgdgdqvrdfihvddvaravlllledpaage.ynlgggepvsvrela
00514911   1/1  lgvpgsliplllraalgggeplpvfgslyltlDgdqvrdfihvddvaraillalenpaaggglllllgvy
00491981   1/1  ql...lsrliprlvkaale.....gkplpiagdg.arrdlvhvdDvadalvlaaenlrkgppargqiyni
00460341   1/1  ..gnllplllraala.....glplpvlgdgdqvrdfihvddvaravlllledpaagevynlgggepvsvr
00491171   1/1  plllraala.....glpltvlgdgdqvrdfihvddvaravlllledpaaggvynlgggepvsvrelaeal
00468971   1/1  gpggrp....gnllplllraalagkp.....lpvlgdgdqvrdfihvddvarailllledpaagevynlg
00493571   1/1  pglrplgvtgsllplllraala.....ggplpvlgdgeqvrdfihvddvaravlllledlpgaigevynl
00482931   1/1  vtsllplflrla....laglpltlvlgdgdqvrdfihvddvaravlllledpa.ggvynlgggepvsvre
00507211   1/1  gfpg...nllplllraala......glplpvgdgdqvrdfihvddvarailllledllaspgatgevynl
00511831   1/1  pgnvygpglrptlvt.sliplfiaailaglpl......rlgdgdqtrdfvhvddvaeavllaledpaage
00430421   1/1  kla.....lkggpllilgdgdqkrdfihvdDvaravvlaledpeatgeiynlggsgeplslrelaellak
00430411   1/1  lrlal.....kggpllilgdgdakrdfvhveDvaravvlaledpeatgkvynlgggseavsvrelaella
00527221   1/1  lllaggl........lllgdgdakrspisvddvaral---------------------------------
00516961   1/1  ...llllgdgdqrrspihvddvaralvaalldpaaag---------------------------------
00532871   1/1  .............lrlggllllgdgdalrsfisvedvadavvlaledpaatge-----------------
00486141   1/1  .....................lgdgtplgrlgtpedvaea------------------------------
00519911   1/1  eall.........lpgllllgdgdakrrpisvedvar---------------------------------
00385591   1/1  ......................lldgtplrrlgtpedvaeav----------------------------
00471781   1/1  ...rtgvllllgdgdglrslisvddvAaalvl--------------------------------------
00482701   1/1  qigsptytldlAdailallllllaggelsgiyhlsgggavswyefalailelaev.lgldlklllvlpip
00354771   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00448531   1/1  gdptyvedlAraillllekgllG.iyhlsgggelswyefalailellgldvevlpisteeyptpadrPan
00502281   1/1  ----------------------------------------------------------------------
00354711   1/1  .......pllrglllpllllalllgellevlgdgiplgrlgtpedvadavlfl-----------------
00527441   1/1  ........glveellaellarip...............l-------------------------------
00456451   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00354051   1/1  ----------------------------------------------------------------------
00421311   1/1  aasKaalegltrslalelap--------------------------------------------------
00482861   1/1  trslarelllllapkgirvn--------------------------------------------------
00468011   1/1  lleallalilpl.....-----------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00424291   1/1  .................lee--------------------------------------------------
00361941   1/1  ...............leelle-------------------------------------------------
00387701   1/1  rg...............llll-------------------------------------------------
00498451   1/1  p...................eellallldgiplgrlgtp-------------------------------
00511091   1/1  aPGlvdtp...................-------------------------------------------
00513551   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DISLAKKYGWKSKMSLITSIRNTYKSFVRENF--------------------------------------
00521161   1/1  aellg..kkipivfvp.rpgdvlrlladi-----------------------------------------
00464721   1/1  pgdvlallldiskarelgwkprysleeglrd---------------------------------------
00371281   1/1  lplvpipfvplragdvlrlvldiskar-------------------------------------------
00462911   1/1  aeliakll..gkkikivfvplrlllllal-----------------------------------------
00519961   1/1  .gkkipiipvplllllllalllefvplrpg----------------------------------------
00383241   1/1  rdfvhvdDvaealllaleapaspnlaleg-----------------------------------------
00519251   1/1  ivfvplrpgdvlrllldiskakkllgwkpkysl-------------------------------------
00419991   1/1  vsvlelaealaeal..glpipivfvplrpg----------------------------------------
00400431   1/1  relaealaell.glpiplievpprrpgdv-----------------------------------------
00498641   1/1  pvsvrelaealakllg..lpipivfvplr-----------------------------------------
00490261   1/1  railllledpaaggtgqvynlggge.vs------------------------------------------
00433371   1/1  glpvpivvvptpllrrpgdvarllldisk-----------------------------------------
00465741   1/1  gepvsvrelaealaell..glpipivpv------------------------------------------
00495191   1/1  ealaell..glpvpivpvplallrllakllelll------------------------------------
00514911   1/1  nlgggepvsvrelaealael.lg.lpip------------------------------------------
00491981   1/1  gngepnvvsllelakelak.alglklev------------------------------------------
00460341   1/1  elaealaeal..glplpllpvplallel------------------------------------------
00491171   1/1  aealglplpl.vefpplrpgdvlrllld------------------------------------------
00468971   1/1  ggepvsvrelaealaealglplpllpvl------------------------------------------
00493571   1/1  gggepvsvrelaealaellglpvpgvpvpiell-------------------------------------
00482931   1/1  laealaell..glplpivpvpdplllrp------------------------------------------
00507211   1/1  gggepnlvsvrelaealaea.lg.lpvp------------------------------------------
00511831   1/1  vynlgggepvsvrelaellaell..grpv-----------------------------------------
00430421   1/1  vl..grplpvvpvplellrlllle----------------------------------------------
00430411   1/1  kalg..kkvpvvpvplellrllll----------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00482701   1/1  tseyptpakrPansvldssklrealgikppdw--------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00448531   1/1  svLdlsklkallgleppdweeglretlew-----------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00456451   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00354051   1/1  ----------------------------------------------------------------------
00421311   1/1  ----------------------------------------------------------------------
00482861   1/1  ----------------------------------------------------------------------
00468011   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00387701   1/1  ----------------------------------------------------------------------
00498451   1/1  ----------------------------------------------------------------------
00511091   1/1  ----------------------------------------------------------------------
00513551   1/1  ----------------------------------------------------------------------