[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21405.1


[Show Plain Result]

## Summary of Sequence Search
   1::336
   1::337   4e-123 50.0% 0046741 00467411 1/1   ase                                     
   1::334 4.5e-120 50.6% 0046606 00466061 1/1   ase                                     
   2::334   1e-117 49.5% 0046689 00466891 1/1   ase                                     
   1::330   1e-116 50.6% 0050945 00509451 1/1   ase                                     
   1::335 2.4e-114 50.7% 0045714 00457141 1/1   ase                                     
   1::335 9.9e-113 50.4% 0045763 00457631 1/1   ase                                     
   1::335 2.2e-110 50.4% 0049000 00490001 1/1   ase                                     
   1::336


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSELNKIALKILSNGKGILAADESNGTMTKRLESVNVPSSPENRLLFRETLFSSSGMKDFIGGVILYDET
00467411   1/1  tsllslltselkeelleiaeklvapgkgilAlDesggtigkrlksigventeenrrayRellltapgflg
00466061   1/1  lslvellkellsllalltselaeeleeiaeklvapgkgilAlDesggtigkrlksigventeenrrayre
00466891   1/1  -llkllllesllsllelltlelkeeLletalaivapgkGilAaDesggtigkrlkligventeelrrayr
00509451   1/1  rllslltselaeeleeiaeklvaggkgilAlDesggtigkrlkligventeenrrayrellltapgllge
00457141   1/1  ltselaeelleiaeklvaggkgilAlDesggtigkrlkligventeenrrayrellltapglgeyisGvI
00457631   1/1  asslslltselaeelleiaeklvapgkgilAlDesggtigkrlksigventeenrrayRellltapgflg
00490001   1/1  lsslslltselkeelleiaealvapgkgilAlDesggtigkrlksigventeenrrayRellltapgflg


                         -         -         *         -         -         -         -:140
query           INQTSNLKQTIPELISESGAVPGIKVDTGAKILAGSHEEKITEGLDGLRERLKDYYKLGARFTKWRGVFN
00467411   1/1  eyisGvILfeeTldqkiddGkpfvdllkekgivPgiKvdkGlvplagangetltkgldgLderlaeykkl
00466061   1/1  llltapglgeyisGvILfeeTldqktidGkpfvdllkekgivPgiKvdkGlvpladgvqlekttqgLdgl
00466891   1/1  ellltapglgeyisGvILfeeTlyqktidGkpfvdlLkekgivPgiKvdkGlvpladgvqlekttqgldg
00509451   1/1  yisGvILfeeTldqktidGkpfvellkekgivPgiKvDkGlvplagvqlekttqgLdglleraaeykklg
00457141   1/1  LfeetldqktidGkpfvellkekgivPgiKvDkGlvplagvqlekttqgLdglleraaeykklgarfakw
00457631   1/1  eyisGvILfeeTlyqkiddGkpfvdllkekgivPgiKvdkGlvplagvqlekttqgLdglleraaeykkl
00490001   1/1  eyisGvILfeeTlyqkiddGkpfvellkekgivPgiKvdkGlvplagvqlekttqgLdglleraaeykkl


                         +         -         -         -         -         *         -:210
query           ISDKYPSKLSIHSNAHALARYSALVQECGMVPIVEPEVLMDGDHAAETCFNKTSEVIQKCFEELLLHKID
00467411   1/1  garfakwRsvlkianglPsalaikenanqlaryAaicqenGLvPIvePevlidgdhdlerealvteevla
00466061   1/1  leraaeykklgarfakwRsvlkianglPselailenanqlaryAaicqeaGLvPIvePevlidgdhdler
00466891   1/1  lleraaeykklGarfakwRsvlkianglpsalaveenaevLaryAaiiqeagLvPIvePevlidgdhkle
00509451   1/1  arfakwrsvlkianglPsalailenanqlaryAaiiqeaGLvPIvePevlidgdhdlerealvteevlaa
00457141   1/1  rsvlkianeegipsvlaiqenanvlaryAaiiqeaglvPIvePevlidgdhdlerealvteevlaavfkl
00457631   1/1  garfakwRsvlkianglPsalailenanvlaryAaicqengLvPIvePevlidgdhdlerealvteevla
00490001   1/1  garfakwRsvlkianglPsalailenanvlaryAaicqenGLvPIvePevlidgdhdlerealvteevla


                         -         -         -         +         -         -         -:280
query           LSGIILKPNMILAGTTSDKKISSEEVAKLTLKCLKENVPTDVPGIAFLSGGQTEVEATENLNLINKYNDT
00467411   1/1  avfklladhgvlLegtllkpnmvtpglask.kaspeevaeatvralrrtvppavpgvvfLsGGqseeeAt
00466061   1/1  ealvteevlaavfklladhgvllegtllkpnmvtpglesakkaspeevaeatvralrrtvppavpgvvfL
00466891   1/1  realvteevlaavfklladhgvllegtlLkpnlvtpgnesakkaspeevalatvlylrltvppavpgvvf
00509451   1/1  vfklladhgvllegtllkpnmvtpglesakkaspeevaeatvralrrtvppavpgvvfLsGGqseeeAtl
00457141   1/1  lsdhgvllegtllkpnmvtpglaskkkaspeevaeatvralrrtvppavpgvvfLsGGqseeeAtanLna
00457631   1/1  avfklladhgvlLegtllkpnmvtpglesakkaspeevaeatvralrrtvppavpgvvfLsGGqseeeAt
00490001   1/1  avfklladhgvllegtllkpnmvtpgleskkkaspeevaeatvralrrtvppavpgvvfLsGGqseeeAt


                         -         *         -         -         -         -         +:350
query           NFIMTYSYGRALQQSALKFWSKDINNTSGTQKVFNHRANMCTLAAQGKWSKELEAK--------------
00467411   1/1  lnLnainklglakpwgltfsygrALqesllkawsgkeenvalaqeilliraaansla-------------
00466061   1/1  sGGqseeeAtanLnainklgllkpwgltfsygRALqesllkawsgkeenvalaq----------------
00466891   1/1  lsGGqseeeatanLnainglialkpWaltfsygrAlqesllkawsgkefnvala----------------
00509451   1/1  nLnainklglakpwgltfsygRALqesllkawsgkeenvalaqeillira--------------------
00457141   1/1  inklglkpwgltfsygRALqesllkawsgkeenvalaqealikrakanslaalGk---------------
00457631   1/1  lnLnainklglakpwgltfsygRALqesllkawsgkeenvalaqeillirakans---------------
00490001   1/1  lnLnainklglakpwgltfsygrALqesllkawsgkeenvkaaqealikrakans---------------