[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21413.1


[Show Plain Result]

## Summary of Sequence Search
   1::241
   5::240  1.3e-88 47.0% 0040484 00404841 1/1   like                                    
   3::240  5.2e-87 48.5% 0040186 00401861 1/1   like                                    
  23::237  1.5e-73 47.2% 0041114 00411141 1/1   like                                    
   1::241


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSANMPKDNIERAI
00404841   1/1  ----skwanikhkkaaqdakrsklftklakeItvAakegggdpelNprLrlaiekAkkanlPkdnIerai
00401861   1/1  --GhskwanikhrkakqdakrgklftklakeitvAakeGgpdpelNprLrlaiekAkkanlPkdnIerai
00411141   1/1  ----------------------klftklakeitvAakeGgpdpelNprLrlaiekAkkanlPkdnierai


                         -         -         *         -         -         -         -:140
query           AKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSGGNLGTQGSASHNFNQLGIIK
00404841   1/1  kkasggldgenleeiryegygpggvalivealTdnrnrtvadvrsafsknggnlgesGsvsylFdrkGvi
00401861   1/1  kkasggldgenleeiryegygpggvalivealTdnrnrtvadvraafsklggnlgesGsvsylFdrkGvi
00411141   1/1  kkasg.dgenleevryegygpggvalivealTdnrnrtaadvraafskngglnlgesgsvsylFdrkGvi


                         +         -         -         -         -         *         -:210
query           IDKKEISDEQIFELAIESGADECISNDEFHEIQCPMSEIYNVKKNLEKTIANFISTEIEWVPLNSVDVEK
00404841   1/1  vvekedldedelleaaleagaedveleeglievltdpedlgavkeaLeeagleiesaeltliPntlvels
00401861   1/1  vv..egldedellelaleagaedvelledglievltdpedlsavkeaLeeaglevesaeltliPntlvel
00411141   1/1  vvekkdleelgldedelleaaleagaedveleegllevltepedlsavkeaLeeaglevesaellliPkt


                         -         -         -         +         -         -         -:280
query           DKVEAALEFLETLEDDDDVQSVYSNINFKNN---------------------------------------
00404841   1/1  deeqaekllklldaLedlddvqnvytnael----------------------------------------
00401861   1/1  deedaekllklldaLedlddvqnvytnlel----------------------------------------
00411141   1/1  lveldeeeaekllklldaLedlddvqn-------------------------------------------