[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21432.1


[Show Plain Result]

## Summary of Sequence Search
   1::637
   1::380  4.1e-85 37.2% 0050394 00503941 1/1   in diphosphate-binding fold (THDP-bindi 
  22::374    1e-75 31.9% 0049136 00491361 1/1   in diphosphate-binding fold (THDP-bindi 
  22::365  1.7e-72 35.6% 0042762 00427621 1/1   in diphosphate-binding fold (THDP-bindi 
   3::350  3.7e-72 32.7% 0040412 00404121 1/1   in diphosphate-binding fold (THDP-bindi 
  26::369    4e-72 33.0% 0036596 00365961 1/1   in diphosphate-binding fold (THDP-bindi 
  18::362  1.4e-71 36.8% 0039197 00391971 1/1   in diphosphate-binding fold (THDP-bindi 
  19::349  1.4e-68 33.0% 0044101 00441011 1/1   in diphosphate-binding fold (THDP-bindi 
 289::484  3.5e-66 42.0% 0042761 00427611 1/1   in diphosphate-binding fold (THDP-bindi 
 314::505    2e-62 40.7% 0042965 00429651 1/1   in diphosphate-binding fold (THDP-bindi 
 293::479    5e-62 43.6% 0039198 00391981 1/1   in diphosphate-binding fold (THDP-bindi 
  51::349  2.6e-60 32.4% 0041402 00414021 1/1   in diphosphate-binding fold (THDP-bindi 
 293::479  5.1e-60 43.6% 0044102 00441021 1/1   in diphosphate-binding fold (THDP-bindi 
 305::479  6.4e-59 41.4% 0049135 00491351 1/1   in diphosphate-binding fold (THDP-bindi 
 315::496  4.2e-58 41.1% 0041403 00414031 1/1   in diphosphate-binding fold (THDP-bindi 
 316::496  4.5e-58 39.4% 0050395 00503951 1/1   in diphosphate-binding fold (THDP-bindi 
 311::490  5.6e-56 39.5% 0039059 00390591 1/1   in diphosphate-binding fold (THDP-bindi 
 316::490  2.5e-55 40.8% 0044440 00444401 1/1   in diphosphate-binding fold (THDP-bindi 
  41::346  6.3e-55 33.1% 0044439 00444391 1/1   in diphosphate-binding fold (THDP-bindi 
 299::478    5e-53 38.2% 0051963 00519631 1/1   in diphosphate-binding fold (THDP-bindi 
  13::368  5.7e-53 28.9% 0049028 00490281 1/1   in diphosphate-binding fold (THDP-bindi 
 296::484  6.2e-46 24.5% 0040413 00404131 1/1   in diphosphate-binding fold (THDP-bindi 
  49::303  2.5e-34 27.2% 0051271 00512711 1/1   in diphosphate-binding fold (THDP-bindi 
 489::626  1.5e-33 38.8% 0036598 00365981 1/1   terminal domain-like                    
 489::626  1.9e-32 34.3% 0044441 00444411 1/1   terminal domain-like                    
 489::626  2.9e-32 40.2% 0039060 00390601 1/1   terminal domain-like                    
 489::626  5.3e-32 39.7% 0042966 00429661 1/1   terminal domain-like                    
 491::626  2.2e-31 35.8% 0041404 00414041 1/1   terminal domain-like                    
 495::626    1e-30 37.2% 0050396 00503961 1/1   terminal domain-like                    
  46::297    4e-29 25.8% 0042488 00424881 1/1   in diphosphate-binding fold (THDP-bindi 
  71::302  1.1e-25 22.8% 0042045 00420451 1/1   in diphosphate-binding fold (THDP-bindi 
  39::282  8.4e-25 29.8% 0048897 00488971 1/1   in diphosphate-binding fold (THDP-bindi 
  48::308  4.2e-24 24.4% 0045130 00451301 1/1   in diphosphate-binding fold (THDP-bindi 
 481::625  2.5e-23 25.0% 0039199 00391991 1/1   terminal domain-like                    
 484::626  6.3e-22 25.4% 0042763 00427631 1/1   terminal domain-like                    
  41::288  1.3e-21 24.9% 0052104 00521041 1/1   in diphosphate-binding fold (THDP-bindi 
 485::626  6.8e-19 25.8% 0044103 00441031 1/1   terminal domain-like                    
  43::296  1.5e-18 24.4% 0049968 00499681 1/1   in diphosphate-binding fold (THDP-bindi 
 486::626  7.7e-18 24.5% 0040414 00404141 1/1   terminal domain-like                    
  66::303    8e-18 25.5% 0041167 00411671 1/1   in diphosphate-binding fold (THDP-bindi 
  46::298  7.4e-16 23.0% 0042102 00421021 1/1   in diphosphate-binding fold (THDP-bindi 
  94::281  1.4e-15 30.4% 0045858 00458581 1/1   in diphosphate-binding fold (THDP-bindi 
 487::626  6.1e-15 25.2% 0049137 00491371 1/1   terminal domain-like                    
 499::579  7.8e-09 21.0% 0035298 00352981 1/1   terminal domain-like                    
   1::637


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQNYKFLKDINFPSDLRKLSENDLQEVSNEVRKEMIDAVSETGGHLGAGLGVVELTVALHYVFDTPNDRL
00503941   1/1  reildllektycgsigvelmhildllgriwlpedleklskeellelyrlmllareleellldlvrqgkig
00491361   1/1  ---------------------LlelyrlalliRrlaldavklangGhlgsflglaellvalyrgfeavdv
00427621   1/1  ---------------------eelyrlalliRrlaldavelangGhlggslgaaelfvalyagfeavnvg
00404121   1/1  --ltpllntipspadllslsdlelldrlanairylaldmvlkanhvklglgGHpgsslgaaellavlfrv
00365961   1/1  -------------------------alrrllidallkavsghpghllglagivevlfalhlvfdppnpdw
00391971   1/1  -----------------kldllqlyrlanliRrlaldavslangGhpgsplgaagleavlvgvflaldpd
00441011   1/1  ------------------edllelyrlalliRrlaldavslangGhlglylglaelaaalfavlrydpdn
00427611   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00391981   1/1  ----------------------------------------------------------------------
00414021   1/1  --------------------------------------------------gvveltvelirvldldgllw
00441021   1/1  ----------------------------------------------------------------------
00491351   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------aysghlgaelgvvllt..lhlvfdpprpel
00519631   1/1  ----------------------------------------------------------------------
00490281   1/1  ------------relvpldlylglteadldrefdlggllglelltlreilallkktycgsigveymhild
00404131   1/1  ----------------------------------------------------------------------
00512711   1/1  ------------------------------------------------eplgpaevlralaealp.edai
00365981   1/1  ----------------------------------------------------------------------
00444411   1/1  ----------------------------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00414041   1/1  ----------------------------------------------------------------------
00503961   1/1  ----------------------------------------------------------------------
00424881   1/1  ---------------------------------------------lggplgpaevlralaellp.ddaiv
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  --------------------------------------rpgllghlglglgpeavlvalaaalp.eddiv
00451301   1/1  -----------------------------------------------splgpqevlralaellp.ddaiv
00391991   1/1  ----------------------------------------------------------------------
00427631   1/1  ----------------------------------------------------------------------
00521041   1/1  ----------------------------------------tdggplspghvlralyelll...lpedaiv
00441031   1/1  ----------------------------------------------------------------------
00499681   1/1  ------------------------------------------pprlcpglgpaavlralskalpelglle
00404141   1/1  ----------------------------------------------------------------------
00411671   1/1  -----------------------------------------------------------------plrpp
00421021   1/1  ---------------------------------------------lcpglgpqevlaalsealp.edaiv
00458581   1/1  ----------------------------------------------------------------------
00491371   1/1  ----------------------------------------------------------------------
00352981   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IWDVGHQTYPHKILTGRKSKIKTLRQGNGLSGFTKRSESEYDPFGAAHSSTSISSALGMAEANKLSNKLN
00503941   1/1  hlgsslGqealavllaaalr.prdrivl..gHrghllylllgl.dllkifrelggksgghpvsehlgvlf
00491361   1/1  gspaaldrddfvlsvGHgsyrlyalllltGrdlsleellgfrqlgglsgghpesghtpgvefttgplGtg
00427621   1/1  apaalnrddfvlsvghgspllyahllltGrdlsaellgnfrqlgsglpghphrgetpgvefttgplGqgl
00404121   1/1  flrydpwlnrdrfvlskGHgspllYallyltGrlseedLknfrqlsfgsglpghpepglmtpgvefttGs
00365961   1/1  lsrdvllqlyrhmlltrrfeefltllqrqgkigrfvlsaGhealalyaalalrgydvifptYRdhgllla
00391971   1/1  dpvwpnrdrfvlsvghgspllyallyltGrldlsledlktfrqlgsglsghpergetpgvefttGplGqg
00441011   1/1  ilwtyrdrfvlsaGhgspllyallyltGrdlsledlktfrqlgsglpghpepetpgvefttGplGqglsa
00427611   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00391981   1/1  ----------------------------------------------------------------------
00414021   1/1  lksgheglsldvllqlyrhmlltrrfeefltllqpggkirgffilseGhealavglalalrgedvlgmay
00441021   1/1  ----------------------------------------------------------------------
00491351   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00444391   1/1  sdeellqlyrhmlltrrfeefllllqrqgkrgffvlsaGhealavgaalalrggedvigmayRgrlnvla
00519631   1/1  ----------------------------------------------------------------------
00490281   1/1  legrwllerleslspeellellrlmlliralelrlvlla.gsgrgghllslagqeallvalalaln.ped
00404131   1/1  ----------------------------------------------------------------------
00512711   1/1  vvsdvGcsqrwaaryltlrrprtfllsgglgtmGy..................glpaAlGaalalp....
00365981   1/1  ----------------------------------------------------------------------
00444411   1/1  ----------------------------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00414041   1/1  ----------------------------------------------------------------------
00503961   1/1  ----------------------------------------------------------------------
00424881   1/1  vtdvGtsqfwaarll..................lpk.prslltsgglgsmGyglpaAlGaalalkllgpd
00420451   1/1  dgdpltpayvlkalsellpddaivvtdvglsqfwarylrfpgprtfltsgglgtmGyglpaAlGaalanp
00488971   1/1  vsdvgchqrwaarlltgrgprtllnsg.lgsmGy..................glpaAlGaalaap....d
00451301   1/1  vtdvGssqfwarylr...................lprprrfltsgglgtmGyglpaAlGaalaap....d
00391991   1/1  ----------------------------------------------------------------------
00427631   1/1  ----------------------------------------------------------------------
00521041   1/1  vsdvgcsqrwgarllgfpeprtflvsgglgimGy..................glpaAlGaala.....pd
00441031   1/1  ----------------------------------------------------------------------
00499681   1/1  daivvsdvgcsqrwaarylrfdkprtfltsgglgsmGy..................glpaAlGaalanp.
00404141   1/1  ----------------------------------------------------------------------
00411671   1/1  lldpglgpqyvlkalsealpelpddaivvsdvGcsqfwaarylrlrrprsfltsgglgtmGyglpaAlGa
00421021   1/1  vsdvGcsqlwaarylrlrg..................prtfltsgglgtmGyglpaAlGaalanp....d
00458581   1/1  -----------------------vkenlldlltvkgsqllqpllefsGacagcgetpylklltqlfgdrl
00491371   1/1  ----------------------------------------------------------------------
00352981   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPVGAMRTYLAKLLTGKIYFSLRETFKL
00503941   1/1  ntghlgtglpvAvGmAlAlkllgkdvvvvaliGDGalseGvvhEAlnlAgllklpvlfvvedNgigistp
00491361   1/1  lpvAvGaAlalkllgelfnrglldlvdrvvvaliGDGalseGvvweAlnlagllklpnlifivdnNgysi
00427621   1/1  slAvGmAlaakllgalfnrplldlvdrvvvafiGDGalseGvfhEalnlAgvlkldnlifvvdnNgysis
00404121   1/1  lGqglsaAvGmAlalkylgarfnkdivdrrvyaliGDGeldeGvswealslaghlkldnlivilddNgis
00365961   1/1  lgvdllkifrelggklpghpeggggsmhlgsetpgvepttgplGtglpaAvGaAlAaklagpdrvvvali
00391971   1/1  lpaAvGaAlaakllgalfnrplldlpdrvvvaliGDGalneGvslealnlAghlkldnlivivdnNgysi
00441011   1/1  AvGaAlalkllgalfnrglldlpdrvvvafiGDGalseGvshealnlaghlklgnlifildnNgysisgp
00427611   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00391981   1/1  ----------------------------------------------------------------------
00414021   1/1  RgrlnvlalgvplkeilaellglrtglskgggvpmhlgspgllgntghlgtglpvAvGaalAakllgkdr
00441021   1/1  ----------------------------------------------------------------------
00491351   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00444391   1/1  lgvplleifaellgklpghpgggdvkmhlgseslgvlfntghlgtglpvAvGaAlAakllgkdrvvvali
00519631   1/1  ----------------------------------------------------------------------
00490281   1/1  pvigd..hRdrlvllghgspllyaflelrgkledlsggrdgsyhpghpelgvefttghlgtglpvAvGma
00404131   1/1  ----------------------------------------------------------------------
00512711   1/1  drrvvaviGDGsf..lmgleelntaarynlpvlivvlnNgg......ygitgglqslttgygysgttlpt
00365981   1/1  ----------------------------------------------------------------------
00444411   1/1  ----------------------------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00414041   1/1  ----------------------------------------------------------------------
00503961   1/1  ----------------------------------------------------------------------
00424881   1/1  rrvvalvGDGsf..gmtlqelataaryglpviivvlnNggygiirqlqeltyggrdlpnpdfak......
00420451   1/1  ....drrvvaivGDGsf..gmtlqelataaryglpviivvlnNggygitrqqqsltyp............
00488971   1/1  rrvvaviGDGsf..lmgleelntaarynlpvvivvlnNggygitrglqeltggeglsgtdlpnpdfak..
00451301   1/1  rrvvaivGDGsf..qmglqelataaryklpviivvlnNng.....................ygiirglqe
00391991   1/1  ----------------------------------------------------------------------
00427631   1/1  ----------------------------------------------------------------------
00521041   1/1  rrvvaiiGDGsfqmgl.qe.lstaarlklpvlivvlnNggygitggqeraggrpsgtdlp..........
00441031   1/1  ----------------------------------------------------------------------
00499681   1/1  ...drrvvaiiGDGsf..lmglqelataaryklpvlivvlnNgg......ygitgqlqettaggrysttd
00404141   1/1  ----------------------------------------------------------------------
00411671   1/1  alarp....drrvvaiiGDGs..flmglqelatavrynlpviivvlnNggygmtrgqqsltygggasgtd
00421021   1/1  rrvvaiiGDGs..flmglqelatavrynlpviivvlnNggygmtrgqqeltgg.................
00458581   1/1  lianatGcssiyggslpttpytlnadgrgPawanslfedaaefglghrlcpgcgrfailrlllkalrelg
00491371   1/1  ----------------------------------------------------------------------
00352981   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IVSAFSKRFSVKAGKAEDFLRSAVTGGTLFNSLGFYYVGPIDGHDLSTLIPILKNARDSKHQGPIMIHIK
00503941   1/1  vgrsrssedladr............................................aeafgipvi.rVd
00491361   1/1  sgpvsralsedladr............................................feayGwpvirv
00427621   1/1  gpvggqt..ledlaa.........................................rfeayGwnvirvvd
00404121   1/1  idgpvglalklledlekrfeaygwnvirviwgslwdallagddlglllqlmaetldg.ayqllkalkgay
00365961   1/1  GDGalseGmvhEalnlagllklpvlfvvenNgyaistptglata..........................
00391971   1/1  dgpvglql..ledlak.........................................rfeayGwnvi.rv
00441011   1/1  vglas..ledlak.........................................rfeayGwnvirviwdG
00427611   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00391981   1/1  ----------------------------------------------------------------------
00414021   1/1  vvvaliGDGalseGvvhEalnlaalyklpvlfvvvnNqigistpverssay...................
00441021   1/1  ----------------------------------------------------------------------
00491351   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00444391   1/1  GDGalseGvvhealnlaallglpvlfvvvNNqigistpvg..............................
00519631   1/1  ----------------------------------------------------------------------
00490281   1/1  lalkllgpdrvvvaviGDGalseGvvhEAlnlagllklpvlivvvdNgigistpvdlrssaye.......
00404131   1/1  ----------------------------------------------------------------------
00512711   1/1  gllllgllpdfak.................laeafGapgv.rvdgpd..eleealeealaa..dgpvlie
00365981   1/1  ----------------------------------------------------------------------
00444411   1/1  ----------------------------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00414041   1/1  ----------------------------------------------------------------------
00503961   1/1  ----------------------------------------------------------------------
00424881   1/1  ..............................laeafGakgvltvrvedveeleaalkealeragdgpvlie
00420451   1/1  .......................gndlpnpdfaklaeafGakyvalgirvetpdeleealkeal..aadg
00488971   1/1  ..............................laeafGakgv.rvdgpd..eleealeeala..gdgpvlie
00451301   1/1  l...fyndlpnpdfak.............laeafGanyvaridghkgvrvdtpdeleealkeala.ksdg
00391991   1/1  ----------------------------------------------------------------------
00427631   1/1  ----------------------------------------------------------------------
00521041   1/1  ........................ppdfaalaeafGapgv.rvdgpd..eleealeeala..gdgpvlie
00441031   1/1  ----------------------------------------------------------------------
00499681   1/1  llgn........................pdfaklaeafGakgv.rvd..dpeeleealkeal..asdgpv
00404141   1/1  ----------------------------------------------------------------------
00411671   1/1  lpnpdfak.......................................laeafGakgvrv...edpeelee
00421021   1/1  ...............grygtdlpnpdfaalaeafGakgv.rvd..dpeeleealkeala..adgpvliev
00458581   1/1  ldlllaelpgklvgvstgi.cssrlppylnsllg..tlhgralgvalglklagpdlvvvvigGDGdaydi
00491371   1/1  ----------------------------------------------------------------------
00352981   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TQKGKGYSYAEKASDHYHGVSKFNVVTGEQVKSGTNLPAYTKVFANTLVKHAERDSKVVGVTAAMPGGTG
00503941   1/1  GhdveavyaalkeakeyaregggPvlieavtyrgkghseadddpskyhgkeeveiekk.........rdp
00491361   1/1  idGnlDveavyaalkealer.gggPvlieaktyrgkghs..eeddpkahrv.pldkeeiealrerdpllr
00427621   1/1  GhDvlavyaalkeaker.gggPtlIeakTykgkglplae.gtlkaHgv.pldpeeyralkevlgwplepd
00404121   1/1  vrellfeelgelkelvedlsdeliyllprdGhdleaiyaalkeakes.kgkPtlIiakTvkgkglplaeg
00365961   1/1  ................sedlaaraeayGipgi.rVdGndvealyaalkealerarsgggPvlIevvtyrg
00391971   1/1  dGhsldveavyaalkeaker.gdgPtlieakTykgkghppae.gttkaHgvylgkeevealrkrlglptg
00441011   1/1  hdveavyaalkeaker.gggPtlIeakTykgkghs..leddakaHgvylgkeevealrkrlglppedlf-
00427611   1/1  --------laeelpeklhavlpflletgkkv.......atrkafgeaLlalakklprlvgisaDlagstl
00429651   1/1  ---------------------------------kgkkltyreafgealaelleedprvvllgedvgrgtg
00391981   1/1  ------------lpeklhavlpfllatg.......kklatrkafgeaLlalaeldprlvgisADlagstg
00414021   1/1  .........................ptllaeafgipgi.rVdGndveavyaalkealeyarkgggPvli-
00441021   1/1  ------------lPdlwhavlpfdlatgkkv.......atrkafgkaLaalakldprlvgisaDltgstl
00491351   1/1  ------------------------lelllpllelgdklatrkafgeaLlalakldpelvggsaDlagstg
00414031   1/1  ----------------------------------gkkltyreafgealaelleedprvvvlgedvgrggg
00503951   1/1  -----------------------------------kkltyreafgealaelleedprvvvlgedvgeggg
00390591   1/1  ------------------------------elekgkkltyreafglalaelleedprvvllgedvgrgtg
00444401   1/1  -----------------------------------kkltyreafgealaelleedprvvllgedvgrgtg
00444391   1/1  ............rqrstpdladraeafgipgi.rVdGnDveavyaalkeaveraragggPvlieav----
00519631   1/1  ------------------lvlkfiletrlklleegkkidyreafglalaelleedprvvllgeDvgrgtv
00490281   1/1  ...................................dlaarfeayGipvi.rvdGhDpeavyaalkeAley
00404131   1/1  ---------------kllsvPalklfagill.sgereisttmafvralvelardkelgkrivpivpdlar
00512711   1/1  vltdrgtgvlpleplgkrlkelv-----------------------------------------------
00365981   1/1  ----------------------------------------------------------------------
00444411   1/1  ----------------------------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00414041   1/1  ----------------------------------------------------------------------
00503961   1/1  ----------------------------------------------------------------------
00424881   1/1  vvtdrgegvspledagk-----------------------------------------------------
00420451   1/1  pvlievltdkgdgvpplvdlgk------------------------------------------------
00488971   1/1  vl--------------------------------------------------------------------
00451301   1/1  pvlievvtdrgdgvlplvplgyrlkeev------------------------------------------
00391991   1/1  ----------------------------------------------------------------------
00427631   1/1  ----------------------------------------------------------------------
00521041   1/1  vltdrgtg--------------------------------------------------------------
00441031   1/1  ----------------------------------------------------------------------
00499681   1/1  lievltdrg..ldplk------------------------------------------------------
00404141   1/1  ----------------------------------------------------------------------
00411671   1/1  alkeala..adgpvlievltdpg-----------------------------------------------
00421021   1/1  lvdpgtgvlplvplgkki----------------------------------------------------
00458581   1/1  G---------------------------------------------------------------------
00491371   1/1  ----------------------------------------------------------------------
00352981   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           MDIFAKDFPKRMFDVGIAEQHAVTFAAGLATEGYKPYVAIYSTFLQRAYDQVVHDVAIQSLPVRFIIDRA
00503941   1/1  ierfakylleegllteeeleelleevaeev----------------------------------------
00491361   1/1  laeflipeglldeaeelkeivaea----------------------------------------------
00427621   1/1  piprlrkyllelgll-------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00365961   1/1  kghstad.dpskyhgkpev---------------------------------------------------
00391971   1/1  eflvpdpilrly----------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00427611   1/1  tllkgllafaedfpgryidvGiaEqgmvaiaaGlalhggliPfvatfstFlqraydqi.rlaalqnlpvi
00429651   1/1  lfrvtvglfakfgpdrvfdtpiaEqgivgfaaGlAlaglrPvveiqfsdflnrAfdqivndvallryrsg
00391981   1/1  lllkgsvdlfakdfpgryidvGiaEqamvaiaaGlalhgegliPfvatfltFldraydqi.rlvalqnlp
00414021   1/1  ----------------------------------------------------------------------
00441021   1/1  tllkllvdikgldlfaeafpgryidvgiaEqamvaiaaGlalhGgrliPfvatyltFldraydqi.rlaa
00491351   1/1  lllkglglldlfakefpgrfidvGiaEqamvaiaaGlalhggliPfvatfltFldraydqirld.Alqnl
00414031   1/1  lfrvtvglfakfgpdRvidtpiaEqgivgfAaGlAlaGlrPvveaqfsdflqrafdqivndaallryrsg
00503951   1/1  vfrvtkglfakfgpdRvfdtpiaEqgivglAaGlAlaGlrPvveiqfsdfllrAfdqivndaaklryrsg
00390591   1/1  lfrvtvglfakfgpdrvfdtgiaEqaivgfAaGlAlaglrPvveaqfsdflnrAfDqiindvallryrsg
00444401   1/1  lfrvtvglfakfgpdrvfdtpiaEqaivgfaaGlAlaGlrPvveaqfsdflnrAfDqivndvailryrsg
00444391   1/1  ----------------------------------------------------------------------
00519631   1/1  lkvtaglfdkfgpdrvfdtpiaEqgivgfaaGlAlaGlrPvveiqfsdflnrAfdqiindvallryrsgg
00490281   1/1  arkgggPvlIeaktyrgk----------------------------------------------------
00404131   1/1  ttgleglfrqlGiysplgqlytpedldlllvyredfpgqilelGiaEagavaalaalatsyslhgegliP
00512711   1/1  ----------------------------------------------------------------------
00365981   1/1  ----------------------------------------------------------------------
00444411   1/1  ----------------------------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00414041   1/1  ----------------------------------------------------------------------
00503961   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00391991   1/1  ----------------------------------------------------------------------
00427631   1/1  ----------------------------------------------------------------------
00521041   1/1  ----------------------------------------------------------------------
00441031   1/1  ----------------------------------------------------------------------
00499681   1/1  ----------------------------------------------------------------------
00404141   1/1  ----------------------------------------------------------------------
00411671   1/1  ----------------------------------------------------------------------
00421021   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00491371   1/1  ----------------------------------------------------------------------
00352981   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GLVGADGSTHAGSFDITYLSTLPNFIVMAPSDEAELVKMTNTSMTINNKPCAIRYPRGNGIGVELPSIDE
00503941   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00427611   1/1  lvgthaGiglgedGptHqgiedlallraiPnltvlrPadavelaaalelalerldgpvylrlsr------
00429651   1/1  gqqnlpvvlrlphggl.ggdGptHss.sdlalfrhlpglkvvaPsdpadakgllraair.ddgPvvirep
00391981   1/1  vifvlthdGigvgedGpTHqpiedlallraiPnltvlrPadavetaaalklalestdgp-----------
00414021   1/1  ----------------------------------------------------------------------
00441021   1/1  lqnlpvilvlthdgigvgedGpTHqgiedlallraipnltvyrPadanelaaalklale-----------
00491351   1/1  pvifvlthdgigvgedGpTHqpiedlallraiPnltvlrPadavelaaalklalelldg-----------
00414031   1/1  gklnvpvvfrlpg.gavggdGptHsg.edlallraipglkvvaPsdpaeakglllaair.ddgPviirep
00503951   1/1  gqqnlpvvirlprgg..gadgathhsqsdeallrhipglkvvaPsdpadakgllraaird.dgPvvfrep
00390591   1/1  gklnvplvl.rlpgglvgedGptHss.sdlalfrhlPglkvvaPsdpaeakgllraairdd.gPvvirep
00444401   1/1  gnlpvplvlrlpggvggdgpthhsledeallrlipglkvvaPsdpadakgllraaird.dgPvvirepkg
00444391   1/1  ----------------------------------------------------------------------
00519631   1/1  eqkvpvvlallpaglgg.dgpthhsasdeallrlipglkvvaPsdpadakgllraair------------
00490281   1/1  ----------------------------------------------------------------------
00404131   1/1  fyilYsmFgfrrlgdliwaaadqqargfllgataGrttLngeGpqHqdghslllaraiPnlvvy------
00512711   1/1  ----------------------------------------------------------------------
00365981   1/1  --------------------------------------------------------------------dy
00444411   1/1  --------------------------------------------------------------------dy
00390601   1/1  --------------------------------------------------------------------dy
00429661   1/1  --------------------------------------------------------------------dy
00414041   1/1  ----------------------------------------------------------------------
00503961   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00391991   1/1  ------------------------------------------------------------ekgevegvak
00427631   1/1  ---------------------------------------------------------------evpeele
00521041   1/1  ----------------------------------------------------------------------
00441031   1/1  ----------------------------------------------------------------vpeeie
00499681   1/1  ----------------------------------------------------------------------
00404141   1/1  -----------------------------------------------------------------leega
00411671   1/1  ----------------------------------------------------------------------
00421021   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00491371   1/1  ------------------------------------------------------------------ssle
00352981   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           NIEIGKGRVIQEGKQVCILSIGTRLEECKIAAAELKNKGIESTIVDARFAKPLDQELILKCAREHEAMIT
00503941   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00427611   1/1  ----------------------------------------------------------------------
00429651   1/1  kgllrlkeevpeeey-------------------------------------------------------
00391981   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00441021   1/1  ----------------------------------------------------------------------
00491351   1/1  ----------------------------------------------------------------------
00414031   1/1  kglyr.----------------------------------------------------------------
00503951   1/1  kglyrl----------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00519631   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00404131   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00365981   1/1  tlpigkaevlregadvtivayGsmvglaleaaellaeelgisaevidlrtlkPldeelilelvkktgrvv
00444411   1/1  tlpigkaevlregadvtlvayGsmvglaleAaelLaeegisvevidlrtlkPldeelilelvkktgrlvv
00390601   1/1  tlpigkaevlregkdvtivayGsmvalaleAaeel...gisaevidlrtlkPldeelilelvkktgrlvv
00429661   1/1  tlpigkaevlregkdvtivayGtmvalaleAaeel...gisaevidlrtlkPldeelilelvkktgrvvv
00414041   1/1  llpigkaevlregadvtivayGsmvglaleAaellakeGisvevidlrtlkPldeelilelvkktgrlvv
00503961   1/1  ----GkaevlregadvtivayGsmvelaleAaeeleeegisaevidlrtlkPldeelilelvkktgrvvv
00424881   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00391991   1/1  gayilkaavlregadvtliatGsevelaleAaelLakegisvrvvslpslkpldeqtieyklevlpktvr
00427631   1/1  gvakGayvlldaregadvtliatGsevelaleAaelLaaegikvrVvslpslkpfdeqtilysasvlpkk
00521041   1/1  ----------------------------------------------------------------------
00441031   1/1  gvpkGkyvlleregadvtlvAtGsevslAleAaelLakegikvrVvslpslkpfdeq...........vv
00499681   1/1  ----------------------------------------------------------------------
00404141   1/1  vegilkGaYvlreaegegpdvtLlasGsevrlaleAaelLakeygidarVvsvpslklldrqglayerav
00411671   1/1  ----------------------------------------------------------------------
00421021   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00491371   1/1  gvakGayvlldaegadvtlvatGsevslAleAaelL.eegikvrVvsvpslepfdaqdeeyllsvlpagv
00352981   1/1  --------glfeyygredadvvivamGstvgtaleavdllraeGikvgvldvrllrPfpeeallealpkt


                         -         -         -         *         -         -         -:630
query           VEEGSIGGFGSHVENLLSEKGIFDKGLKFRTMILPDIFIEQDSPKKMYDVAGLNASQISKKILDILFTKE
00503941   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00427611   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00391981   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00441021   1/1  ----------------------------------------------------------------------
00491351   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00519631   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00404131   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00365981   1/1  vveegsltgglgsevaallaeegfldldapvlrlglpdvfiphg....ledlygldaegiveavle----
00444411   1/1  veenvltgglgsevaellaeegfllldapvlrlggpdvfiphg....ledlygldaegiveavkel----
00390601   1/1  veegaltgglgsevaallaeegfldldapvlrlglpdvfipha...elldlygldaediveavlel----
00429661   1/1  veenaltgglgsevaellaeegfldldapvlrlglpdvfiphg....leallgldaegiveavlel----
00414041   1/1  veegvltgglgsevaaalaeegaflyllapvlrlggpdvfiphak..eledllgldaegiveavle----
00503961   1/1  veegvllgglgsevaallaeegflgldapvlrlglpdafiphg...ellelygldaegiveavkel----
00424881   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00391991   1/1  lvvvvEagvtlgwlgyv............gleglvlgvdg.fgasgpadelleefgltaenivaa-----
00427631   1/1  tgrvvvveeavllgwlg............ylgapvlrvgidd.fgasapaeellelfgltaenive----
00521041   1/1  ----------------------------------------------------------------------
00441031   1/1  tyeesvlpgglglvvvealasagwdkyv...grvggidtfgasapadellklfgltaeniveavke----
00499681   1/1  ----------------------------------------------------------------------
00404141   1/1  llspekterlvtveellag..gpvvavtdaveavleqlwervpgldvvvlgtdgfGasdtreelre----
00411671   1/1  ----------------------------------------------------------------------
00421021   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00491371   1/1  pvvaveagvtlgwlgya................gavigidrFgasapadelyehfgltaeniveav----
00352981   1/1  vkkvvvlErnkeagglggp---------------------------------------------------


                         -         +         -         -         -         -         *:700
query           SIKVVKN---------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00427611   1/1  ----------------------------------------------------------------------
00429651   1/1  ----------------------------------------------------------------------
00391981   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00441021   1/1  ----------------------------------------------------------------------
00491351   1/1  ----------------------------------------------------------------------
00414031   1/1  ----------------------------------------------------------------------
00503951   1/1  ----------------------------------------------------------------------
00390591   1/1  ----------------------------------------------------------------------
00444401   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00519631   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00404131   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00365981   1/1  ----------------------------------------------------------------------
00444411   1/1  ----------------------------------------------------------------------
00390601   1/1  ----------------------------------------------------------------------
00429661   1/1  ----------------------------------------------------------------------
00414041   1/1  ----------------------------------------------------------------------
00503961   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00451301   1/1  ----------------------------------------------------------------------
00391991   1/1  ----------------------------------------------------------------------
00427631   1/1  ----------------------------------------------------------------------
00521041   1/1  ----------------------------------------------------------------------
00441031   1/1  ----------------------------------------------------------------------
00499681   1/1  ----------------------------------------------------------------------
00404141   1/1  ----------------------------------------------------------------------
00411671   1/1  ----------------------------------------------------------------------
00421021   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00491371   1/1  ----------------------------------------------------------------------
00352981   1/1  ----------------------------------------------------------------------