[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21456.1


[Show Plain Result]

## Summary of Sequence Search
   1::131
   2::129  9.4e-28 38.9% 0039545 00395451 1/1   Signal peptidase                        
  22::128  4.9e-26 40.0% 0044449 00444491 1/1   Signal peptidase                        
  37::130  2.7e-18 36.3% 0037364 00373641 1/1   Signal peptidase                        
   1::131


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLTIPFYLHKAGAGFPSPATDYIEEDVDLNVHLIKNVPATFIIRVQGKSMTDVGIYDGDLLVIDRSLKP
00395451   1/1  -lvliPllg.lvsaGfpsladdevedtilldllll.npsnlfalrVeGdsMepagildGdlllvdkslea
00444491   1/1  ---------------------eyvedlldlllllvlrpgdlfalrvsGdsmepagildgdlllVdpslta
00373641   1/1  ------------------------------------lpgdlfalrvkGdsMiaplggepgildGdlvlvd


                         -         -         *         -         -         -         -:140
query           KNFSTVVANVHDELVVKSFVRSKDGQFLTSGSKNIEDKIIIGDESEVFIWGVVTYVIHSTY---------
00395451   1/1  rngdivvarldgeatvKrlirlgggilllslNpdyppividldeddleiiGvvvgvird-----------
00444491   1/1  rdgdivvarldgeltvKrlvr.ggrvlLlslNpd.yppilidaeddveiiGvvvgvir------------
00373641   1/1  psltarngdivvalldggeatvKrlvreggrvlLlplNpdyppilld...ddveiiGvvv----------