[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21520.1


[Show Plain Result]

## Summary of Sequence Search
   1::794
 565::796    6e-33 23.7% 0039249 00392492 2/2   drug efflux transporter AcrB transmembr 
 592::791  1.7e-29 24.5% 0039248 00392482 2/2   drug efflux transporter AcrB transmembr 
 144::394  7.9e-27 24.3% 0039249 00392491 1/2   drug efflux transporter AcrB transmembr 
 191::390  2.9e-25 25.4% 0039248 00392481 1/2   drug efflux transporter AcrB transmembr 
   1::794


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSLFYQNIVLKNPKSIFILLLITLLSFGYFSKDFRLDASSDTLLIEGDPDLEYLKEVTERYGSKEFLIL
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TYSPNEGMVTESSINNLLSLKYKIQSLDWVHSVITLLDIPLLNNSEAPLQERLESFKTLKDEGVDTERGF
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NEILNSPVFRNFVISEDGKTSGIIVYIKKDELKDIENKSAQEIEEYKDTLKKKNHENITQIREVIKTYGD
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ---idlvlgpslisrengkravlvrvnlrggdltseeavalalallagalp..................a
00392481   1/2  --------------------------------------------------gantgevvdavrallee.al


                         -         -         -         +         -         -         -:280
query           VGKIYLGGIPMITDDMMSFIKSDIIVFGLGVLLFIIATLWFIFRKLIWIIVPISSCFFSVLIMTGLLGLL
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  gvsvevgg......dleeq.......alllalllifllllllfrslrlallallalplaligalgllall
00392481   1/2  pagvtv.evtgvsadlieeaisdlllalllalllvflvlllflrslraalivllalplsllgalgllall


                         -         *         -         -         -         -         +:350
query           GWKVTVISSNFIALMLILTMAMNIHMSTRFLQLREDFPNLDNLKIIIMTTSKMFWPIIYTVLTTICAFLS
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  giplsllslaglilliGiavddsillvdrireellr..egldlreaiiealrrrlrpilltalttllgfl
00392481   1/2  gislnllslvglilliGlgvddaivlverireelr.eeglslreailealrergrpilltalttilgflp


                         -         -         -         -         *         -         -:420
query           LVFSGIKPIIDFGWMMTLGLITSFIITFTLLPTLLSFMSSNKVKIKEDADSKITSFFGKISINNKSIIFL
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  plllstglgspflrgfalalaigllvstlltlfllPallallgr--------------------------
00392481   1/2  lafsggaggpllrpfaltlalglllstllaltllPallal------------------------------


                         -         -         +         -         -         -         -:490
query           VTGLVVVLSVVGISKLEVENSFINYFNKNTEIYKGMKLIDEKLGGTTPLEVILKFPENIIVETTEDDEFE
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SWDDEGSKDDEKYWFTKDKIEKIQNVHNYLDNLPAVGKVLSFSSIIEVATQLNNNKPLGTLEMGVLYSKI
00392492   2/2  ----------------------------------------------------------------------
00392482   2/2  ----------------------------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PETIKKDIIDPYISIKDNEARISLRIIDSQDGLRRNDLINQINYDLENELKLSKEEFKLAGVLILFNNLL
00392492   2/2  ----idlvlgpslisrengkravlvrvnlrggdltseeavalalallagalpagvsvevgg.........
00392482   2/2  -------------------------------gantgevvdavrallee.alpagvtvevtgvsa...dli
00392491   1/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           QSLFKSQILTLGLVMVGIFAMFMILFRNFKLSLIGVVPNFIAAFFILGIIGLLGIPLDMMTITIAAITIG
00392492   2/2  dleeq....alllalllifllllllfrslrlallallalplaligalgllallgiplsllslaglilliG
00392482   2/2  eeaisdlllalllalllvflvlllflrslraalivllalplsllgalgllallgislnllslvglilliG
00392491   1/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           IAVDNSIHYIYRFKEEFLKIKDYNKTLKVCHSTVGVAILNTSITIVFGFSILVFSKFIPTIYFGVFTGLA
00392492   2/2  iavddsillvdrireellregldlreaiiealrrrlrpilltalttllgflplllstglgspflrgfala
00392482   2/2  lgvddaivlverireelreeglslreailealrergrpilltalttilgflplafsggaggpllrpfalt
00392491   1/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           MLLAMISVLTLLPSLILISKPFGK----------------------------------------------
00392492   2/2  laigllvstlltlfllPallallgrr--------------------------------------------
00392482   2/2  lalglllstllaltllPalla-------------------------------------------------
00392491   1/2  ----------------------------------------------------------------------
00392481   1/2  ----------------------------------------------------------------------