[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21535.1


[Show Plain Result]

## Summary of Sequence Search
   1::485
 164::485 1.4e-117 50.6% 0040437 00404371 1/1   pendent exopeptidases                   
 163::482 7.8e-115 51.4% 0038334 00383341 1/1   pendent exopeptidases                   
   1::164  6.2e-06 22.2% 0038333 00383331 1/1    domain-like                            
   1::485


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTIQINYKKISSKKDLANLVLFVDEKFNINNLKKYLSNLEFSYISDLLKNSDLKKDLLSFEVNSKKTVFL
00404371   1/1  ----------------------------------------------------------------------
00383341   1/1  ----------------------------------------------------------------------
00383331   1/1  Mefsvkavsleklkgda.lvvgvfegeklspaakaldealggllsellkegdfkgkagetlllylvpglg


                         -         -         *         -         -         -         -:140
query           VSIKKDIKISDIENLGAKFHSYINNDKKKEYFVNSDTINNKIKNFVGYFLHGLKLKSYEFNIYKSKKNKE
00404371   1/1  ----------------------------------------------------------------------
00383341   1/1  ----------------------------------------------------------------------
00383331   1/1  akrvllvGlGkeeelneeelrkagaaaaralkklkvkevavlldelpvdgrdaawlaeaaaegallglYr


                         +         -         -         -         -         *         -:210
query           TVLINVIGNKNKISIQDHLRFKALEEGSFFARDLVSEPGNVLHPDEYAKRINTLKKFGLKINIYDEKKLK
00404371   1/1  -----------------------laeavllardlvntPanlltPellaelavelakelglgvkvevldee
00383341   1/1  ----------------------alaeavllardlvntPanlltPellaelavelakelgekvkvevldee
00383331   1/1  fdrykskkkepkpvlkkltllvsg----------------------------------------------


                         -         -         -         +         -         -         -:280
query           KLGMNALLGVGQGSIRGSYLVTMEWNGAKNNSNPLAFVGKGVCFDTGGYSLKPAKFMEDMTYDMAGSATV
00404371   1/1  eleelgmgallaVgkgsaepprlvvleykgkgdeekkplalvGkGitfDtGGlslkpsagmlgmkldmgG
00383341   1/1  eleelgmgallaVgkgsaepprlvvleykgkgdsekkplalvGkGitfDtGGlslkpsagmllmkldmgG
00383331   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VGLMKNLAIRKAKINAVGVVGLVENMVSGNAQRPGDIVKSYSGKTIEVLNTDAEGRLVLADALTFTEKKF
00404371   1/1  AAavlgallalaelklpvnvvallalaenmiggnalrpgdvltslsGktvevlntdaeGrLvLaDallya
00383341   1/1  AAavlgallalaelklpvnvvallalaenmvggnalrpgdvltslsGktvevlntDaeGrLvLaDallya
00383331   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KPKFMVDLATLTGAIIVSLGSEYAGLFSNDDKLSKQLLEAGDKVEEKLWRMPLHKNFDKLIDSKNADMQN
00404371   1/1  se.lkpdliidvATLtgaavvalGndlaglfsnddalaealleageavgelvwrlplleeylelllkssv
00383341   1/1  se.lkpdliidvATLtgaavvalGndlaglfsnddalaeelleageatgelvwrlplleeylellkssva
00383331   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           INYVGGAGSTTAAQFLQRFILNKTPWAHLDIAGMAFSKYGGALNSGGATSYGVRLLNQLIEDNYE-----
00404371   1/1  aDllnvglgrlagaitaalFLsefv.edlpwaHlDiagtallsgdlgllpkgatglgvrllvell-----
00383341   1/1  Dllnvg.grlagaitaalFLsefvg.dlpwaHlDiagtal....lgllpkgatglgvrllve--------
00383331   1/1  ----------------------------------------------------------------------