[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21597.1


[Show Plain Result]

## Summary of Sequence Search
   1::281
  58::281  8.5e-73 44.1% 0047268 00472681 1/1                                           
  54::278  1.6e-70 43.1% 0041525 00415251 1/1                                           
  61::278  9.6e-67 46.2% 0038911 00389111 1/1                                           
  61::282  9.9e-67 46.7% 0049351 00493511 1/1                                           
  63::280  2.3e-66 46.0% 0041438 00414381 1/1                                           
  69::278  1.9e-65 48.0% 0038910 00389101 1/1                                           
  38::277  8.3e-55 39.9% 0043774 00437741 1/1                                           
   1::281


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFLRIGKAGQEIPVALDRNGKYRNLSSIIKDLNSETINFETLDKIKDINLENLEEVNQNERIGSCISKP
00472681   1/1  ---------------------------------------------------------lrivdlldpvasp
00415251   1/1  -----------------------------------------------------yavqlllvrlllaplpp
00389111   1/1  ------------------------------------------------------------vrllapl.pp
00493511   1/1  ------------------------------------------------------------vrlllaplpp
00414381   1/1  --------------------------------------------------------------lllalgpr
00389101   1/1  --------------------------------------------------------------------pp
00437741   1/1  -------------------------------------lslltiealadaLlearregkpippltdalppl


                         -         -         *         -         -         -         -:140
query           GNFFAIGLNYVEHAKETGAKTPDNPVLFNKSVHSIVGPNDNVIIPKTSKKLDHEVEIAFVIGKKAKRVLE
00472681   1/1  gkiicvglnyrdhaaelgpnvpelPvlflkrasslvgpgdpivrPlGqllpddaeepvfglskrldyElE
00415251   1/1  vkivcvglnyaahaeelgvdlpdepvlFlkpasalvgpgdpiplpsgsiqldyEaElavvigkdlrgvsv
00389111   1/1  gkivcvglnyaahakelgvelpeePvfflkpassvvgpgdpiplpagseqldyEaElavvigkdgrgvsa
00493511   1/1  gkiicvglnyaahaeelgvdvpeePvlFlkpasslvgpgdpiplpagsllldyEvELavvigkggrnvsa
00414381   1/1  vkivcvglnyaahakelgvdvpdlPvlFlkpasslvgpgdpiplplgqllpealegleedgadseepvls
00389101   1/1  gkiicvglnyadhakelgltsgavlalllpeePvfflkpasslvgpgdpiplpalse.ldyEaELavvig
00437741   1/1  dledAyaiqlalvelllavgepvvgikvglnyaahakelg...pdePvlflkpadavvgdgapiplppli


                         +         -         -         -         -         *         -:210
query           KDAQDYIFGYCICNDISEREWQKEKGGQWVKGKSGDTFGPLGPYLVTKDEIQDVNNLNLTLDVNGHRHQT
00472681   1/1  LavvigkglelgrnisvedaldhifGytllnDvsaRdlqarelvglgwflaKsfd..tplgPwivtadel
00415251   1/1  edaldyvagytlgnDvsardlqlrlkakgldwvadkafdgfaplGpwivtadelgdladlgltlrvngel
00389111   1/1  edaldyvagytlgnDvsardlqkkiglpwtlakgfdgfaplGpwivtldelgdladlgltlrvngevvqd
00493511   1/1  edaldavagytlanDvsardlqleekakglpwlagKsfdgfaplGpwivtadel.dpadlrlrlrvngel
00414381   1/1  asiqldyEaElavvigkdgrnvslldvedAldyvagytlinDvsardlqleekkkglpwtlaknfdtfap
00389101   1/1  kdgrgvsvedaldyvagytlgnDvsardlq..kglpwtlaksfdgsaplGpwivt....pdpanlrltlr
00437741   1/1  .qpdyEvElavvlgkdlpgrdvtledaldavagytpaleitdrrlqdwkiklldwladkafdgslvlGpw


                         -         -         -         +         -         -         -:280
query           GNTNQMIFNFNFLVAHITSFITLMPGDIVTTGTPPGVGLGMDPPVFLKEGDEMKLNIDSLGSQNSKVILE
00472681   1/1  epfrvagpeqdpeplpylddeggdpldlrlelrvngelrgeatllqdgntsdmifsvaeliahlsrngmt
00415251   1/1  vqdgntadmifspaelvaylsngmtLeaGdviltGTpsgvg.......plkpGdvveveieglgtlsn--
00389111   1/1  gntadmifspaeliahlsrgmtLepGdliltGTpsgvg.......plkpGdvveveieglgtlsntvv--
00493511   1/1  vqdgntsdmifsvaeliaylsngmtLepGdviltGTpsgvg.......plkpGdvveleieglgtlsntv
00414381   1/1  lgpwvvtadelgparldlanlglrlrvngelvqdgntadmlfspaeliahlsngmtLepGdliltGTpsg
00389101   1/1  vngevvqdgntadmifsvaeliaylsngmtLrpGdviltGTpagvg.......plkpGdvveveiegl--
00437741   1/1  ivtldal.dlanlglvltvnGevvqtgntaamlgdpaelvawlsnflaalgitLeaGdviltGtpag---


                         -         *         -         -         -         -         +:350
query           Q---------------------------------------------------------------------
00472681   1/1  L---------------------------------------------------------------------
00415251   1/1  ----------------------------------------------------------------------
00389111   1/1  ----------------------------------------------------------------------
00493511   1/1  ve--------------------------------------------------------------------
00414381   1/1  ----------------------------------------------------------------------
00389101   1/1  ----------------------------------------------------------------------
00437741   1/1  ----------------------------------------------------------------------