[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21667.1


[Show Plain Result]

## Summary of Sequence Search
   1::204
  19::204  4.2e-38 29.7% 0050207 00502071 1/1   hydrolase                               
  22::203  4.8e-38 30.2% 0047668 00476681 1/1   hydrolase                               
  22::204  8.1e-32 26.7% 0051447 00514471 1/1   hydrolase                               
  24::202  2.5e-26 30.5% 0046880 00468801 1/1   hydrolase                               
  24::202  2.9e-26 31.7% 0046616 00466161 1/1   hydrolase                               
  23::198  9.3e-26 28.1% 0036388 00363881 1/1   hydrolase                               
  21::198  1.3e-21 23.7% 0046617 00466171 1/1   hydrolase                               
  18::205  3.5e-07 24.1% 0051808 00518081 1/1   hydrolase                               
   1::204


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKRFIIKIIAVCLVSINVNALENVILFGDSLMAGYGLPQEKHLAIVLQNNLNDSGYDLGIIDGSVSGST
00502071   1/1  ------------------skkplrivalGDSitagygdppgggwvgllaallaalgpgvtvinlGvsGdt
00476681   1/1  ---------------------plrilllGDSitagyglspgggwpallaeal...gagvtvinlgisGdt
00514471   1/1  ---------------------plrilllGDSitagygasgpgggwpallaellaarfgrgvtvinlGisG
00468801   1/1  -----------------------lllallllpvllllgllvwlsllalalalakekplrilflGDSitag
00466161   1/1  -----------------------rivflGDSitagwglte......gwpella....gltvinlGigGdt
00363881   1/1  ----------------------krivllGDSltagyglgsggagWgdlLasyl.....gvevvNlaisGa
00466171   1/1  --------------------eplryvalGDSytaGpgagplldapgaedgClRssnnypallaaalglkg
00518081   1/1  -----------------kdvligdvwllsGQSNmegrgkvldlpeelvanyprirlfsvlralsiipldd


                         -         -         *         -         -         -         -:140
query           SAGGLNRVEWSLSQPNIDLMILGLGANDMLRGISPIETEKNLEKIIQTAKLKNIEIILAGMIAPTTHGIS
00502071   1/1  tagllarleellllrlealkpdlvvlllGtNDllrvlgrpgvsleeyrenlrailellr.pgakvllvgp
00476681   1/1  tadglarldalllalkpdlviillGtNDllrgvspeefranlralierlrapgakvvlvtpppppnylnd
00514471   1/1  dttadllarldrlllalkpdlvvillGtNDllllrgvsleefaanlralidrlrapgakvvlvtpppvge
00468801   1/1  wgls..ggwrella........glevinlGisGdttadllarleedvldnlkpdlvvlmlGtNDl..gls
00466161   1/1  tadllarlerdvldrlkPdlvvlllGtNDl..glspeeilanlealiellraklPgakivllgilpvgel
00363881   1/1  ttrsflaegrldavldllkkpdlvliefGhNDakllgldnlrlllpglgkellvlvlnlrgvpvdefkan
00466171   1/1  ipdvdlvnlacsGattadvlnrldgglgevdvlpqidaln.pdtdlvtltiGgNDlgfadvltaCvlall
00518081   1/1  lgewvlaseplwvladpgtvggfgvalfFarlllkelgvpnavvglissawGgtsieawlsggtlyngmi


                         +         -         -         -         -         *         -:210
query           YKKKFDNIYPSLAQKYELNLIPFLLEGVALKPELNQEDGMHPNEKGTIIISDTLTKSIINFIKK------
00502071   1/1  ppvpelllprlnervaelnaalrelaeelgvpfvdlfsllldeegllpellaaDglHpnaaGye------
00476681   1/1  ylaalndalrelakelgvplvdlfallldldgelllaDglHpnaaGyrliaealaeallkllg-------
00514471   1/1  lpnrlnerlaaynaalrelaaelgvpfvdlysalldlaglpelllpDglHpnaaGyrllaeala------
00468801   1/1  peeiaenlralieliraklPgakilllgllpvgerpnylnerikelnellkelakelpgvtf--------
00466161   1/1  gdrlnekiaalnealrellakeegvpfvdlysllldedgllpelltaDglHpnaaGyallae--------
00363881   1/1  leaiidrlraagakvvlltplprlnfgsgtlrryleayneaarelAeelgvplvDlfa------------
00466171   1/1  llsllagllvdllslgagcgdaldaardktlrdltldalaanldevldairaaaPnar------------
00518081   1/1  aplkaalgkgykikgviwyqGenDalrgtsaeaykkllkaliedlradlgapdlpfiivqla...-----