[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21725.1


[Show Plain Result]

## Summary of Sequence Search
   1::388
 125::263  8.1e-48 43.2% 0039920 00399201 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 126::263  1.8e-47 42.8% 0049076 00490761 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   2::149  3.5e-37 33.6% 0043068 00430681 1/1   )-binding Rossmann-fold domains         
 290::389  1.4e-12 20.0% 0049075 00490751 1/1   xy-D-xylulose-5-phosphate reductoisomer 
 290::386  2.3e-12 20.7% 0047751 00477511 1/1   xy-D-xylulose-5-phosphate reductoisomer 
   1::151  1.8e-11 17.2% 0039919 00399191 1/1   )-binding Rossmann-fold domains         
   1::74   1.5e-06 27.5% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
   1::64   0.00012 22.2% 0052326 00523261 1/1   )-binding Rossmann-fold domains         
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIAIFGSTGSIGSSLLKIIKDDQKNFKIELLTVNKNYKKLIKQVKLFNVKNVIVTDYNSFLITTKLLK
00399201   1/1  ----------------------------------------------------------------------
00490761   1/1  ----------------------------------------------------------------------
00430681   1/1  -kpkkvavlGatGsiGtstldvlrrnpdrfevvalsagsnvellaeqakefgpevvvvadedlaeelkea
00490751   1/1  ----------------------------------------------------------------------
00477511   1/1  ----------------------------------------------------------------------
00399191   1/1  pikvallGltGtVGqgvvklLeenpelfevvalragrnvalkvelvleykdaavavrdedkprelkdllv
00502281   1/1  mmkvlitGAtGfiGselvrlLle.hgdhevtaldrrtsagklln....epgvevvegdltdpddlekalk
00523261   1/1  kalkkikvailGAtGyvGqellrlLlnh.pevelvalassssagkklsdllplllglkdlvvle------


                         -         -         *         -         -         -         -:140
query           NAKVKVFNNFDSLNKIFNTNNKIDYSMCAISGFDGLKPTLDIIKFTKTIAIANKESIICGWNLIKKDLKK
00399201   1/1  ------------------------------------------------------eslvlaGellleaake
00490761   1/1  -------------------------------------------------------slvvaGelllelake
00430681   1/1  laglgvevlagaealvevaal..dadlvvaaivGaagllptlaaieagktialANKelslvlagalllal
00490751   1/1  ----------------------------------------------------------------------
00477511   1/1  ----------------------------------------------------------------------
00399191   1/1  eegveledllltddalelvedpdvdvvvellgGllalelvlaaleaGksvvtANKallalhgaelaeaae
00502281   1/1  gvDv------------------------------------------------------------------
00523261   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YKTYFVPVDSEHFSIWSLLDNNKKNNFEKIYITASGGPFRNLSLKKFRNISVKDALKHPNWSMGKKITID
00399201   1/1  sgakllPvDsehsaifqllegellkelgllslslngvekllltasGGpfrdlsleelanvtpeealkHPn
00490761   1/1  sgakllPvDsehsaifqllegldlsgvekliltasGGpfrdlsleelanvtleealkHPnWsmGakitid
00430681   1/1  akelgvell-------------------------------------------------------------
00490751   1/1  ----------------------------------------------------------------------
00477511   1/1  ----------------------------------------------------------------------
00399191   1/1  eagvGgiPiik-----------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00523261   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           SATMMNKVFEIIEAKKIFNLNYKQLEILIHPKSYLHAIVKFNNGLSKLLVHDTNMTIPIFNSIYFNTDKK
00399201   1/1  WsmGrkitvdsatllnkgleviealllfglslekievvvhpqsiihslveyld-----------------
00490761   1/1  satllnkgleviealllfdldlekievvvhpqsivHslveyldgsvlaqlglP-----------------
00430681   1/1  ----------------------------------------------------------------------
00490751   1/1  ----------------------------------------------------------------------
00477511   1/1  ----------------------------------------------------------------------
00399191   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00523261   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LKSKNIDIKTLNNLNLKKIDNIRFPVIKILNNLSNEDSLFETIIVSANDKLVKLFLNNKIKFNDISNTLI
00399201   1/1  ----------------------------------------------------------------------
00490761   1/1  ----------------------------------------------------------------------
00430681   1/1  ----------------------------------------------------------------------
00490751   1/1  ---------klgsltFeepdlerfPalklayealraggtapavlnAAnEvavaaFlegkigFldiaelve
00477511   1/1  ---------klgsltFeepdlerfPalklayealraggtapavlnAAnEvavaaFlegkigFldIaelve
00399191   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00523261   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KICNTPEFNKFKSMKPRNIDEIQNLNDYVSLKISSMSV--------------------------------
00399201   1/1  ----------------------------------------------------------------------
00490761   1/1  ----------------------------------------------------------------------
00430681   1/1  ----------------------------------------------------------------------
00490751   1/1  kvleal.....sllelpsledvleldalarelareliee-------------------------------
00477511   1/1  kvleal.....sllelpsledvleldalarelarel----------------------------------
00399191   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00523261   1/1  ----------------------------------------------------------------------