[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21732.1


[Show Plain Result]

## Summary of Sequence Search
   1::378
   2::347  6.2e-19 20.2% 0046716 00467161 1/1   lycosyltransferase/glycogen phosphoryla 
   1::349  1.4e-09 17.1% 0044616 00446161 1/1   lycosyltransferase/glycogen phosphoryla 
   1::378


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIFILTGEPSGDKLASTVISKLKMNNPNIEYLSVGGTHIKKLGIKSIFDLKEITYLGFTSVLFNIFKI
00467161   1/1  -mKilivtgtrpeiiklaplaralkkrpghevtlivtgqhyglldqfleelgipidpd.....lplllgg
00446161   1/1  kkkkilvvtGtRPeaiklaplvreleedpglelvlvvtGqh.....ydlllqviefdglgidpdlnlllg


                         -         -         *         -         -         -         -:140
query           RKKINKTVEEIIKFNPDILFSVDSPDFTLRVAEKVKNINHNIKIIHYVAPQVWVWRKNRVKKIKKFIDHI
00467161   1/1  lslalltgrvliglakvlreekpDvvlvhgdtvstlaaalaakk..lgipvvhveaglrtfdrysgapee
00446161   1/1  sqslakitgllllgleevleelkPdlvlvlGdttetlaaalaaf..ylniPvaHveAGlrtfdlyspfPe


                         +         -         -         -         -         *         -:210
query           LLLFNFEKKYFDEENIKNTFVGHPLIEKKDNVITSLDNLISKDKKIISLFPGSRKSETSVLLPILLNFIK
00467161   1/1  lnrrlidrladlhfapsefarenllkegipperifvvgnpvidalfklaekalrppllsrselleklgld
00446161   1/1  einrh.lidkladlhfaptelarenLlqeGvdpervfvvGnpvidalllsreelleklgldlkryvlvtl


                         -         -         -         +         -         -         -:280
query           LMNKKKLDHLFVFHATDENKEFIINKVKKTNLDNIDIISDEDIKNQVLSNSIFAVSKSGTISLQISSANI
00467161   1/1  pdkkvilvtghrrlnedkglelllealaellerlpdvrlvivghgntrgrlelikllg..lpdnvrllgp
00446161   1/1  hrrenlgs.lenlaealeallellpdllvilpvhpnttvrllllellellpnvllieplgyldflsllka


                         -         *         -         -         -         -         +:350
query           PSIIIYKLGFINFMIFKLLVNVRFANIINIINDKEVIPELLQKECNAEEIYKTVTYFLKNPELIEKQLVD
00467161   1/1  lgyldllallaaadlvvtdsGgvvlEamalGkPvvvlrdtgerpe.....lvdagtgilvg......---
00446161   1/1  adlvltdSGgvqeEapalgvPvlvlrdtterpegveagtvilvgtdperileavslllsdpealermae-


                         -         -         -         -         *         -         -:420
query           CKKTLEGIKSKSSSSSEAALILNNYLVS------------------------------------------
00467161   1/1  ----------------------------------------------------------------------
00446161   1/1  ----------------------------------------------------------------------