[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21850.1


[Show Plain Result]

## Summary of Sequence Search
   1::366
   6::209    1e-78 54.9% 0039907 00399071 1/1   RibB                                    
   6::206  1.3e-78 52.7% 0037940 00379401 1/1   RibB                                    
   4::204  3.2e-72 51.7% 0044038 00440381 1/1   RibB                                    
   7::202  1.9e-71 51.3% 0042499 00424991 1/1   RibB                                    
 207::366    2e-19 24.4% 0052081 00520811 1/1   like                                    
   1::366


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKNNYASIESIINIAKKGGMFILVDDEKRENEGDLIISTTDSSAKNINFMAKYGRGLICLALDSVQAKR
00399071   1/1  -----llsieeaiealraGklvlvvddedrenegdlvlaAelvtpelinfmarhasGliclalteelakr
00379401   1/1  -----llellglllssieeaiealraGklvlvvddedrenegdlvlaaelvtpelinfmirhasGlicla
00440381   1/1  ---llllsieeaiealraGklvlvvddedrenegdlvlaaelvtpelinflvrlasGliclalteeraer
00424991   1/1  ------lsieeaiealraGklvlvvddedrenegdlviaAelvtpelinflvrhasGliclalteeraek
00520811   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LNLSLMSPINQSRNKTAFTISIEAKKGITTGISAKDRAKTIKIASKKNANKKDIVSPGHVFPIIAKDGGV
00399071   1/1  lgLplmvdlndssygtaftvsidaaelgvtTGisaadRaltiraladpdakpedlvrPGHvfplrardgg
00379401   1/1  lteelaerlgLplmvedntsdlgtaftvsvdaaegvtTGisaadraltiraladpdakpedlvrPGHvfp
00440381   1/1  lgLplmvednsddlgtaftvsvdaalgvtTGisaadRaltirlladpnakpedlvrPGHvfplrardggv
00424991   1/1  lgLplmvdlnteasellelleelleddleddlgtaftvsvdar.gvtTGisaadRaltiraladlveeee
00520811   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LVRAGHTEASVDISKLAKKNNSAVICEIMNEDGTMAKGQDLFDFANKHNLKIGKIEDLIAYRLKKEKLIK
00399071   1/1  vleRaGhtEaavdLarlaglkpaaviceilnddeeaegealeedgtmarldellefaeehglklitied-
00379401   1/1  lrakeggvleRaGhtEaavdLarlaGlkpaavicellnddgtmarlpellefaeehglklitiedl----
00440381   1/1  leRaGhteaavdLarlaglkpaavicellneddgtmarldellefaeehglklitiedlieyrl------
00424991   1/1  ldalpedfvrPGHvfplrardggvleRaGhteaavdLarlagllpaavicellnddgsmarl--------
00520811   1/1  ------------------------------------------------------------------slve


                         -         -         -         +         -         -         -:280
query           LKKQSDIKVKNQKYKIRIYENLLDGSEHFALIKGNIKKGIIPRVRVISSNVVQNYLINQQLPNSFDKTLN
00399071   1/1  ----------------------------------------------------------------------
00379401   1/1  ----------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  rvaeaelptlfgefrlvayrdlidglehlalvkGdidddepvlvRvhsecltgDvlgslrcdcgwqLeaa


                         -         *         -         -         -         -         +:350
query           YFKKFNNCVLVFIKDTNLKSVTQTLKDYKNKNFYKKGNDKLIRNYGIGAQIIKDLKIKNMILITKSLKKV
00399071   1/1  ----------------------------------------------------------------------
00379401   1/1  ----------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  leliaeegrGvlvylrqegrgigllnklrayalqdegldtveanealgfpadlrdyglgaqiLrdlgvsk


                         -         -         -         -         *         -         -:420
query           IGLEGYDIKITKQEII------------------------------------------------------
00399071   1/1  ----------------------------------------------------------------------
00379401   1/1  ----------------------------------------------------------------------
00440381   1/1  ----------------------------------------------------------------------
00424991   1/1  ----------------------------------------------------------------------
00520811   1/1  irlltnnprklvgLeg------------------------------------------------------