[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21852.1


[Show Plain Result]

## Summary of Sequence Search
   1::351
   1::140  2.2e-42 41.6% 0051897 00518971 1/1   ine deaminase-like                      
 141::353    3e-42 30.5% 0051896 00518961 1/1   rofolate reductase-like                 
   1::140  2.4e-36 43.9% 0053055 00530551 1/1   ine deaminase-like                      
   1::144  4.8e-30 41.7% 0050283 00502831 1/1   ine deaminase-like                      
 141::353  9.3e-28 28.1% 0053054 00530541 1/1   rofolate reductase-like                 
   1::146  1.2e-27 39.6% 0044240 00442401 1/1   ine deaminase-like                      
 138::353  9.1e-26 26.7% 0051866 00518661 1/1   rofolate reductase-like                 
   1::141  1.9e-25 39.8% 0051482 00514821 1/1   ine deaminase-like                      
   1::141  7.6e-25 36.8% 0050730 00507301 1/1   ine deaminase-like                      
   1::145  6.2e-24 39.9% 0050639 00506391 1/1   ine deaminase-like                      
   1::139  2.3e-23 39.7% 0051891 00518911 1/1   ine deaminase-like                      
   1::123  3.5e-23 42.6% 0051727 00517271 1/1   ine deaminase-like                      
   1::144    1e-22 36.8% 0052851 00528511 1/1   ine deaminase-like                      
 141::351  3.4e-12 21.9% 0036228 00362281 1/1   rofolate reductase-like                 
  18::96   2.3e-10 38.9% 0035093 00350931 1/1   ine deaminase-like                      
 141::350    2e-07 24.8% 0053378 00533781 1/1   rofolate reductase-like                 
   1::351


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MELALNLAKARHGLTGINPSVGCVIVKNNKILSIGQTGFKGTPHAEFNAIKNSHENIEGSKMYVTLEPCS
00518971   1/1  ldeyfmrlAlelArraldlgevnPlvGAvivkdgeiiatgynrvlptaHAEvnAlrqagvllkgatlyvT
00518961   1/1  ----------------------------------------------------------------------
00530551   1/1  ldeyfmrlAlelArralgltagnvpvGAvivkdgeiiatgynrvdgtaHAEvnAlrqaarggerlkgatl
00502831   1/1  mddeyfmrlAlelArrs...tdpnppvGAvivkdgeiiatgyngvpsgnalclevlallelllallglll
00530541   1/1  ----------------------------------------------------------------------
00442401   1/1  leldeyfmrlAlelarraldlg..nvpvGAvivdkkdgeiiargynrvlggndptaHAEinalrqaarlg
00518661   1/1  ----------------------------------------------------------------------
00514821   1/1  selpeddeyfmrlAlelarral..tygnvpvGAvivkdgeiiatgynrenaggdptaHAEinAirqaakl
00507301   1/1  lddeyfmrlAlelarral..tygnvpvGAvivddgeiiatgynrvnagldptaHAEinAirqaarllggy
00506391   1/1  mlsddeyfmrlAlelarralapgsefp.vGAvivkdgeiiatgynvengsydptaHAEinAirqaarklg
00518911   1/1  meldeyfmrlAlelarralpyg..nfpvGAvivkdgeiiatgynrvnaggdptaHAEinAirqaarllgg
00517271   1/1  addeyfmrlAlelarralplg..nvpvGAvivkdgeiiatgynlenasgdptaHAEinAirqaarllggr
00528511   1/1  lssllplllkallldlllsdlrleldeyfmrlAlelArr..aldagnvpvGAvivdpsdgeiiatgynrv
00362281   1/1  ----------------------------------------------------------------------
00350931   1/1  -----------------nfpvGAvlvtddgriytGanvenaaynllrtlhAEqtAianavlnges.eiat
00533781   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HYGKTPPCTNIIIKNKIKEVVYGVEDIDKKVKGKTLNILKSKNILVKKDLLKKQINKFYAPYFFNRKKNL
00518971   1/1  lePCsmlgktPpCagaiiqagikrvvygasdpdlgvagsglellrnagievvvgvleeealellldfflr
00518961   1/1  ----------------------------------------------------------------------
00530551   1/1  yvTlePCshlgktpmCagaiiqagikrvvygaldpdlgvag.glllllnagievvvgvleeealellkdf
00502831   1/1  ldgglprlldlesldglllslllllsgelleldptaHAEinAirqaaklgerlkgatlYvTlePC.....
00530541   1/1  ----------------------------------------------------------------------
00442401   1/1  gellkgatlYvTlePC......pmCagaiiqagikrvvygasdpdl....gglglllnagievvvgvlee
00518661   1/1  -------------------------------------------------------------------tgr
00514821   1/1  lggyrlkgatlyvtlePC......pmCagaiieagikrvvygasdpdlgalgsgldllpeaflnhgievi
00507301   1/1  rlkgatlyvtlePC......pmCagaiieagikrvvygasdpdlgalgsgldllrlaglnvrveviggll
00506391   1/1  gerlkgatlyvtlePC......pmCagaiieagikrvvygasdpdlgvlgllglllleslgievevlggv
00518911   1/1  erlkgatlyvtlePC......pmCagaiieagikrvvygasdpdlgalgsgldllpeaflnhgievivg-
00517271   1/1  rlkgatlyvtlePC......pmCagaiieagikrvvygasdpdlgalgsgldl-----------------
00528511   1/1  lgsgdptaHAEinAlrqaarllggvrlakylltgatlYvTlePC......pmCagaiiqagikrvvygas
00362281   1/1  ----------------------------------------------------------------------
00350931   1/1  iyvtlePCgh......Crqvlveagi--------------------------------------------
00533781   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PYVTGKIAISKNNLIYSKDTKRISDIHTDRFTHFLRYKNDSLMISSKTLNKDDPKLNCRLEGLSKFSPKR
00518971   1/1  ----------------------------------------------------------------------
00518961   1/1  PyvilklavSlDGfiatpdgsskwitgeesralvhllrarvdailvGrgTvlaDnplltvrllgl.grsP
00530551   1/1  ----------------------------------------------------------------------
00502831   1/1  .pmC------------------------------------------------------------------
00530541   1/1  PfvtlklAmslDgkialadgdspwitge.dralvhrlralvdailvGrgTvladnPlltvrlvgl..rqP
00442401   1/1  eaiell----------------------------------------------------------------
00518661   1/1  PfvilklatSlDGkiatadgds.witgeearalvhelraeadailvGrgTvladdplltvrllgl.grqP
00514821   1/1  g---------------------------------------------------------------------
00507301   1/1  e---------------------------------------------------------------------
00506391   1/1  leeea-----------------------------------------------------------------
00518911   1/1  ----------------------------------------------------------------------
00517271   1/1  ----------------------------------------------------------------------
00528511   1/1  dpda------------------------------------------------------------------
00362281   1/1  pkvilivavsldgvig.dgdlpwilpedlahfkeltagvdavlmGrkTfesippplp.........nrln
00350931   1/1  ----------------------------------------------------------------------
00533781   1/1  lrp.vtlivavsldgvialdgdlpwltlpedlklfkeltagadflgkidailmGrkTyesdgpklrp...


                         -         -         -         +         -         -         -:280
query           IILDRNLEIKKNSYIFKTANKDNTIIFYYNAKAEVKLMLKKKGITLIKSKLNKNSFDIKSILMKLYVLGC
00518971   1/1  ----------------------------------------------------------------------
00518961   1/1  lrvvldsslklpldaklfdldgaptivltssladldklsllkklgveviflg..dgrldlaellakLkel
00530551   1/1  ----------------------------------------------------------------------
00502831   1/1  ----------------------------------------------------------------------
00530541   1/1  lrvvldsslrlpldaklfplpgr.ptivltrsea......llaegvevlvl....grvdleellellaer
00442401   1/1  ----------------------------------------------------------------------
00518661   1/1  lrvvldsslrlpldaklfrt..gaptivvttelapaalnervallrglgvevivlg..dgrvdlaallaa
00514821   1/1  ----------------------------------------------------------------------
00507301   1/1  ----------------------------------------------------------------------
00506391   1/1  ----------------------------------------------------------------------
00518911   1/1  ----------------------------------------------------------------------
00517271   1/1  ----------------------------------------------------------------------
00528511   1/1  ----------------------------------------------------------------------
00362281   1/1  iVlsrslrlpldgnvvlvag....................................dleealallkergi
00350931   1/1  ----------------------------------------------------------------------
00533781   1/1  ...lpgrlniVlsrsldlpl........................................egvvvvsgdl


                         -         *         -         -         -         -         +:350
query           RNLLVEGGNDLSKHIIKKKLFNEFYLYKCSKSLSKLVNHKEFGFLKELKKNYKNKLKINKKLGKDVITLY
00518971   1/1  ----------------------------------------------------------------------
00518961   1/1  ginsvlveGGgtlagsllkaglvDelilfiapvllggkggiplfgglglleladalrlklvsvrtlgddv
00530551   1/1  ----------------------------------------------------------------------
00502831   1/1  ----------------------------------------------------------------------
00530541   1/1  ginsvlveGGgtlagsfl..glvdeliltiapkllgggtplpglglel.lslalrlklvsveqlgddlll
00442401   1/1  ----------------------------------------------------------------------
00518661   1/1  LkerginsvlveGGgtlagslleaglvDeliltiaPvllGgggpltlvgglgfpsladalrlelvsvrrl
00514821   1/1  ----------------------------------------------------------------------
00507301   1/1  ----------------------------------------------------------------------
00506391   1/1  ----------------------------------------------------------------------
00518911   1/1  ----------------------------------------------------------------------
00517271   1/1  ----------------------------------------------------------------------
00528511   1/1  ----------------------------------------------------------------------
00362281   1/1  edvlviGGaelyaslleaglvdeliltvipvllge.....gdtlfpgldealrlelvsvevlgedgvvll
00350931   1/1  ----------------------------------------------------------------------
00533781   1/1  eealallkeallllgikdvlviGGaelyasfleaglvdelyltiapvllgg.....gt.lfpgldlslwl


                         -         -         -         -         *         -         -:420
query           K---------------------------------------------------------------------
00518971   1/1  ----------------------------------------------------------------------
00518961   1/1  lll-------------------------------------------------------------------
00530551   1/1  ----------------------------------------------------------------------
00502831   1/1  ----------------------------------------------------------------------
00530541   1/1  lyy-------------------------------------------------------------------
00442401   1/1  ----------------------------------------------------------------------
00518661   1/1  gdd-------------------------------------------------------------------
00514821   1/1  ----------------------------------------------------------------------
00507301   1/1  ----------------------------------------------------------------------
00506391   1/1  ----------------------------------------------------------------------
00518911   1/1  ----------------------------------------------------------------------
00517271   1/1  ----------------------------------------------------------------------
00528511   1/1  ----------------------------------------------------------------------
00362281   1/1  r---------------------------------------------------------------------
00350931   1/1  ----------------------------------------------------------------------
00533781   1/1  ----------------------------------------------------------------------