[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21934.1


[Show Plain Result]

## Summary of Sequence Search
   1::247
  73::241    2e-37 31.7% 0044596 00445961 1/1   /beta knot                              
  80::241  8.3e-36 28.4% 0038338 00383381 1/1   /beta knot                              
  87::242    1e-32 27.9% 0047409 00474091 1/1   /beta knot                              
  97::241  6.6e-30 28.7% 0041137 00411371 1/1   /beta knot                              
   1::82   1.4e-12 36.2% 0038339 00383391 1/1   like                                    
   1::247


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNKSSFLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYTSKDQI
00445961   1/1  ----------------------------------------------------------------------
00383381   1/1  ----------------------------------------------------------------------
00474091   1/1  ----------------------------------------------------------------------
00411371   1/1  ----------------------------------------------------------------------
00383391   1/1  lsllllklkknseliyGlhavleaLkngprkilklyvtegredkrlkellelakelgipvqlvdkkrLdk


                         -         -         *         -         -         -         -:140
query           MHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDGLIVKERQFPSDSKLM
00445961   1/1  --qgvvalvrllrilslldl...rklplvvvldnvqdpgNlGaiiRtaaafgvdglilvgpraf..npkv
00383381   1/1  ---------lllrlldllelldlrkldlvvvldnvqdpgNlGailRtaaafgvdlvilvglradlldkkv
00474091   1/1  ----------------llellelrksplllvldnvedpgNlGailRtaaafgvdalilplgr.dlldpkv
00411371   1/1  --------------------------dllvvlvepedpgNlGaiiRtaaafgvdlvllvplgfdlldkkl
00383391   1/1  ltg..gavHqGv----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFTEIKWEGKNVLLFGSEGFGMREHTGK
00445961   1/1  lraalgalellplvvvddlaealedlkeagylvvattlregsvplteldlpgpvalvfGnEgtGlseell
00383381   1/1  lraalgalellplvvvdnlaealellkeagllvvattlegsvllldvdlpgpvalvlGnEgaGlseelle
00474091   1/1  lraalgalellpvarv.nlaealellkeagllvvattlegsvllldvdlpepvalvlGnEgkGlseelle
00411371   1/1  lraalgalellplarvtnladllealkdaglliltta..gsvsltdvdlggpvalvfGnEgtGlseelle
00383391   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YTDFFVKIDINKDVESLNISNSAAIVFHHLSYLKKNS---------------------------------
00445961   1/1  eladllvrIPmlglveSLNvsvAaaillyea---------------------------------------
00383381   1/1  ladllvrIPmlglveSLNvsvAaaillyeal---------------------------------------
00474091   1/1  ladllvrIPmlglveSLNvsvAaaillyealr--------------------------------------
00411371   1/1  lleadllvrIPmlglvrSLNvavAaaillye---------------------------------------
00383391   1/1  ----------------------------------------------------------------------