[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21946.1


[Show Plain Result]

## Summary of Sequence Search
   1::110
   2::110  1.1e-30 41.3% 0050590 00505901 1/1   edoxin-like                             
   8::104  1.4e-25 38.1% 0039303 00393031 1/1   edoxin-like                             
   5::108  2.3e-25 36.4% 0045879 00458791 1/1   edoxin-like                             
   5::108  4.7e-22 29.3% 0040257 00402571 1/1   edoxin-like                             
  16::98   1.9e-20 41.0% 0047046 00470461 1/1   edoxin-like                             
  16::102  1.5e-19 36.6% 0046836 00468361 1/1   edoxin-like                             
  15::93   2.3e-19 39.5% 0045754 00457541 1/1   edoxin-like                             
  12::91   7.3e-17 31.1% 0041456 00414561 1/1   edoxin-like                             
  17::106  8.1e-13 28.2% 0039431 00394311 1/1   edoxin-like                             
  16::96   1.2e-12 37.5% 0049125 00491251 1/1   edoxin-like                             
   1::95   4.7e-08 21.1% 0038800 00388001 1/1   edoxin-like                             
   8::91   1.9e-07 20.5% 0047714 00477141 1/1   edoxin-like                             
   1::103    2e-07 27.3% 0050617 00506171 1/1   edoxin-like                             
  16::97   5.6e-07 32.9% 0038457 00384571 1/1   edoxin-like                             
   5::103  9.3e-07 21.5% 0051595 00515951 1/1   edoxin-like                             
  16::99   1.9e-06 27.6% 0051532 00515321 1/1   edoxin-like                             
  29::90   9.3e-05 22.6% 0036792 00367921 1/1   edoxin-like                             
  17::103  0.00015 23.2% 0051483 00514831 1/1   edoxin-like                             
   1::110


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDDSTKNLIQGHIETNEVCLFMKGTPDAPQCGFSMAVSNMLKILEVNYKGINVLESQSLREGIKEFSDWP
00505901   1/1  -lldllerikelisenkvvlytkgtpgrptcpfckrakalLdslgveyevidvledpelreelkelsgwp
00393031   1/1  -------rikklisenkvvlYtkslcpyprcgfdcrrvkaiLdalgvdyeevdilldeeareelkellgs
00458791   1/1  ----llekikklisenkvvlfsk.....ptCpycrrakqlLeelgveyeevdvveldlllddpelrdelk
00402571   1/1  ----llelleellskkkvvlFsa.....pwCpyCrkakplLeelgveyeevdvvlldvlkvdaelreela
00470461   1/1  ---------------nkvvlysk.....ptCpyclrakrlLeelgveyeevelveldvledgelrqelll
00468361   1/1  ---------------nkvvlYsk.....ptcpfcrrakllLeekgvpyeevdvdldpelreellelsgvg
00457541   1/1  --------------mnkvvlytkpt...plCpyCvrakrlLdelgveyeevdvdeldllldpeareelke
00414561   1/1  -----------likenkvvlytk.....ptCpfcrkakllLdekgvdyeevdidldpe.reellelsgvg
00394311   1/1  ----------------mitlYgk.....pnCgtsrkalalLeeagieyevvdlledplsreelkkllgll
00491251   1/1  ---------------kpvvlfta.....pwCpfCkkakplLeelgveyevvdvdvdeelrellkey.gvr
00388001   1/1  kltdelfellkelsgkvvvvvfsa.....pwCpyCkrakplleelavlypevelvkvdadefqelaeeyg
00477141   1/1  -------elkellvmakltLysf.....plcpfsqrvrllLeekgvpfelvevdl.eekpeellklnplg
00506171   1/1  llldslldllallikkpvlvlFtk.....pgCplCkkakelLeelaeeygvelvevdidedp....elae
00384571   1/1  ---------------mkvtlYtk.....pgCpyCrrakalLeelgvdyeevdvdedpelreel.kllgvr
00515951   1/1  ----liellelvsvvklltleeleellksgkpvvvvfga...pwCpyCrklapileelaeelkvkfvkvd
00515321   1/1  ---------------mkvtLYsypt.....CpfcrkvrlaLdekgipyelvevdl...kreellklsglg
00367921   1/1  ----------------------------plspfslrvrllLeelglpyelvlvdlldgeqkreellklnp
00514831   1/1  ----------------mvtiYtk.....pnCptcrkakalLeekgieyeeidilkdplsreelkellgll


                         -         -         *         -         -         -         -:140
query           TIPQVYIKGEFVGGCDIVKEMYENGELKKVLEDKGINFKK------------------------------
00505901   1/1  tvPqvfiggeligglddllelhesgeLlelLkeagalllg------------------------------
00393031   1/1  gwptvPqlfvggeliggsddllelleegeLdelL------------------------------------
00458791   1/1  eltgvrtvPqvfiggeligGlddllellesgeLlelLk--------------------------------
00402571   1/1  ellgvrtvPtlfidgklvggsddlvglleegeleelLk--------------------------------
00470461   1/1  kelsgvrtvPqifidgeliggyddllel------------------------------------------
00468361   1/1  tvPvlfidgeliggsddileyleegeldplLk--------------------------------------
00457541   1/1  lsgvrvlllltvPqvfindgeli-----------------------------------------------
00414561   1/1  tvPvlfidgkliggsddivey-------------------------------------------------
00394311   1/1  glgvrellntrgttykelglddkslseeellellle----------------------------------
00491251   1/1  tvPvlfidgelvggldkdellel...--------------------------------------------
00388001   1/1  vrgvPtifingkeiggglpsldell---------------------------------------------
00477141   1/1  kvPvLviggevlgeslaIley-------------------------------------------------
00506171   1/1  ryg.rtvPvlfidgkligggdl.....degeLe-------------------------------------
00384571   1/1  tvPvlviggkvvggfdslaileylgel-------------------------------------------
00515951   1/1  vdenelldeiqelaekygvrgvPtlvifkdgkv-------------------------------------
00515321   1/1  tvPvlvigdgdggevigesdaIleyLeel-----------------------------------------
00367921   1/1  lgkvPvLvddglvlteslaI--------------------------------------------------
00514831   1/1  gvpvifllntkgttykglgldlkalseeelldl-------------------------------------