[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ21961.1


[Show Plain Result]

## Summary of Sequence Search
   1::337
  28::338  6.3e-90 33.0% 0048625 00486251 1/1   tin-like                                
   1::308  3.1e-89 31.8% 0050978 00509781 1/1   tin-like                                
  25::325    4e-89 33.2% 0049426 00494261 1/1   tin-like                                
  23::303  3.9e-86 33.0% 0049497 00494971 1/1   tin-like                                
  22::307  8.2e-84 31.7% 0044579 00445791 1/1   tin-like                                
  23::309  1.2e-80 33.5% 0049090 00490901 1/1   tin-like                                
  24::305  3.3e-79 32.0% 0047609 00476091 1/1   tin-like                                
  25::304  1.1e-78 34.2% 0047097 00470971 1/1   tin-like                                
 192::315  2.2e-06 20.3% 0048157 00481571 1/1   tin-like                                
  38::230  8.5e-05 18.9% 0051533 00515331 1/1   tin-like                                
   1::337


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNTKIIQPPKEEIVKPQKMGLLVENPVYKPFRYPWCYDAWLTQQRIHWLPEEVPLGDDVRDWQKNLTQSE
00486251   1/1  ---------------------------ndvldepilnlgnpvralnlnpieypwalelykkalanfWlpe
00509781   1/1  alkifnlspvdvlkepillgenvnr....lnlnpieypwalelykkalanfWlpeeidlskDlkdwk.kL
00494261   1/1  ------------------------elvdvlllkllllellsvnaldepillgnsvrlnlypikypdawel
00494971   1/1  ----------------------slkslfndllpvevldeeillgenvdrlnlnpieypkalelykkalan
00445791   1/1  ---------------------nlnalnlnpikypwalelykkllanfWlpeeidlskDvkdwk.kLteee
00490901   1/1  ----------------------vnrlnlnpikypwalelykkalanfWlpeeidlskDlkdwk.kLteee
00476091   1/1  -----------------------lkeeledllkelllleedldlellellsslklllelkklllselkvl
00470971   1/1  ------------------------kldvsdeplllgnpvrlvlwpieypkalelykkalanfWlpeeidl
00481571   1/1  ----------------------------------------------------------------------
00515331   1/1  -------------------------------------delllelekvvegnldrlldveklwqphdflpw


                         -         -         *         -         -         -         -:140
query           KNLLTQIFRFFTQADVEVQNCYLRHYTTVFKPTEVLMMMTAFASMETVHIAAYSHLLDTIGMPESEYSAF
00486251   1/1  eidlskDlkdwk.kLteeerdailrvlafltllDslvgenlalallelvtdpeaeaylatqafmEaiHse
00509781   1/1  teeereailrvlafltllDslvgrnlaeallplvpdpearaylatqafmEaiHsesYsliletlgldpde
00494261   1/1  ykkalanfWlpeeidlskDvkdwe.klteeerlallrllaflaaldslvgrnlvaallelvpdpearayl
00494971   1/1  fWlpeeidlskDlkdwesgkLteeerdailrllafltlldslvgenlalallelvpdpearaylatqafm
00445791   1/1  rdfylrvlafltllDslvnrnlllallplvtlpeirayltfqafmEaiHsesYsliletlfldeeidelf
00490901   1/1  rhfikrvlafltllDslvgenlalallplvtapearavlafqafmEaiHsesYslildtlglde.erdei
00476091   1/1  vldeplllgnltrlnlnpikypwawelykkalanfWlpeeidlskDlkdwetkLteeerdallrvlafla
00470971   1/1  skDlkdwd.klteeerdallrilafltlldslvgrnlvaallelvpdpearaylatqaamEarHseaYsl
00481571   1/1  ----------------------------------------------------------------------
00515331   1/1  dpgenfwllddidwde.ldaelrdellwllsafllgEealllyaallarafgddgallyaltqwtaEEar


                         +         -         -         -         -         *         -:210
query           MKYKEMKDKYDYMQNFDMSSKKDIALTVAVFSAFTEGLQLFASFAILLNFPRHNKMKGMGQIVTWSVRDE
00486251   1/1  sYsliletlgldeeidelfdaienlpalqkkaewllkl..yddesllkal.vasvllEgilfysgFaiil
00509781   1/1  lfdailelpalqkKadwlldfyeelldllsllellgelellldgeelelnllelkksllkklvaf.vllE
00494261   1/1  atqafeEaiHseaYsllletlgldeeedevfnaietypallkkadwllklyddddesllealvaf.vllE
00494971   1/1  EaiHseaYsllletlgvdpdelfdailelpalqkkadwllklyedllgslltlglleteedlllklvafs
00445791   1/1  dailedpalkkkadwllklyddd..slleklvafv.llEgilfyssFaailylaerglmpglaeiielIs
00490901   1/1  fdaiennpalqkkaewllklydd..eslleklvaf.vllEgilfysgFaailylarrgllpglaeiielI
00476091   1/1  alDslvgrnlvlallslvpdpearaylatqafmEaiHseaYsllletlgldpserdelfnaieeypalqk
00470971   1/1  lletlgvdpeerdelfdailelpallkkadwllklyddsresflealvaf.vllEgilfyssFaiilala
00481571   1/1  ---------------------------------------------------aangdtltptlissiqtDe
00515331   1/1  Haealrrylyltgrvdpdylertrlellldgyla.derdp.......lallaytlvvEgaalaayralar


                         -         -         -         +         -         -         -:280
query           TLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFIDLAFEMGPMQGLTAQDVKLYIRFIA
00486251   1/1  alarrgllpglaeiielisrDEalHlafgvlllnlllkelpeleteeleeevyelfkeavelEkefidel
00509781   1/1  gilFyssFaiilalarrgllpglakiielIsrDEalHlafgvlllnrlleklekpelldvteeleeevve
00494261   1/1  gilfyssFaiilylarrgllpglaeiieliarDEalHlafgvlllnrlleelp.......eeevlelfre
00494971   1/1  vliEgilfyssFaiilalakrgllpglaeiieliarDEalHlafgilllnrlleelpeleteeleeevle
00445791   1/1  RDEalHllfagllfnlllnelpeletkelkdevyelfleavelEkefirlllp...llglnad.vlqYve
00490901   1/1  srDEalHllfagllfnlllkelpeletkelkeevyelfreavelElefidlllpd....glnaddvkqYi
00476091   1/1  kadwllkwyddsdesllealvaf.vllEgilfyssFaiilylarrglmpglaeiielIsrDEalHlafgv
00470971   1/1  rrgllpglaeiieliarDEalHlafgilllnrlleelpe.......eevlelfreavelevefidlllpy
00481571   1/1  arhlrwgyallkalleedpelgddnrellqewldkwfwravraltpllgilsdypgid...aaealeair
00515331   1/1  aagd....pvlaellkriar--------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NRRLSQLGLEPIYDVDKNPLTWLDSMLNAVEHMNFFEGRSTEYSKAATQGTWTEAFS-------------
00486251   1/1  lpv...lglnad.vkqyieyvanrrlvnlgleplfpvsenpllpwilallslngvkkt------------
00509781   1/1  lfleavelEkefidlllpegsllglnae------------------------------------------
00494261   1/1  avelelefiddllp.yellglnaelvkqyieylanrrlvnlglep-------------------------
00494971   1/1  lfleavelekefadlllpeg.ll-----------------------------------------------
00445791   1/1  yladrrlvnLgleplynleaenplpwi-------------------------------------------
00490901   1/1  eylanrrlmnlgleplfnvaaenplpwve-----------------------------------------
00476091   1/1  lllnrllkelp.......eeevlel---------------------------------------------
00470971   1/1  gvl.glnaelvkeyvryvanrrlv----------------------------------------------
00481571   1/1  aafeerladlgldllkylg..lkvpldalveav.l-----------------------------------
00515331   1/1  ----------------------------------------------------------------------