[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ22048.1


[Show Plain Result]

## Summary of Sequence Search
   1::333
 119::303    8e-40 30.7% 0050040 00500401 1/1   )-binding Rossmann-fold domains         
   5::146  3.5e-38 35.2% 0041738 00417381 1/1   -like                                   
 120::295  8.7e-37 37.6% 0050890 00508901 1/1   )-binding Rossmann-fold domains         
   5::161  2.7e-33 34.9% 0050889 00508891 1/1   -like                                   
 120::322  1.6e-32 32.8% 0050204 00502041 1/1   )-binding Rossmann-fold domains         
   5::172  1.5e-31 33.8% 0047654 00476541 1/1   -like                                   
 123::308  2.1e-31 27.8% 0048799 00487991 1/1   )-binding Rossmann-fold domains         
 120::328  2.7e-31 32.8% 0048516 00485161 1/1   )-binding Rossmann-fold domains         
   3::163  1.9e-29 32.8% 0051263 00512631 1/1   -like                                   
   2::173    5e-29 30.8% 0049685 00496851 1/1   -like                                   
 120::292  7.7e-29 32.7% 0051264 00512641 1/1   )-binding Rossmann-fold domains         
 120::306  8.2e-29 33.5% 0047481 00474811 1/1   )-binding Rossmann-fold domains         
   5::161  1.2e-28 35.1% 0047480 00474801 1/1   -like                                   
   1::163  7.6e-27 32.3% 0047994 00479941 1/1   -like                                   
   5::163    1e-26 26.5% 0048862 00488621 1/1   -like                                   
   1::189  4.4e-25 32.8% 0046724 00467241 1/1   -like                                   
   5::161  1.2e-24 29.3% 0043275 00432751 1/1   -like                                   
   1::142  3.4e-24 28.1% 0050202 00502021 1/1   -like                                   
 120::326  2.9e-23 30.1% 0051327 00513271 1/1   )-binding Rossmann-fold domains         
 149::275  3.1e-23 32.3% 0042906 00429061 1/1   )-binding Rossmann-fold domains         
   5::151  3.6e-23 27.1% 0040817 00408171 1/1   -like                                   
   5::171  4.5e-23 31.5% 0048672 00486721 1/1   -like                                   
   5::146  6.5e-23 30.1% 0042905 00429051 1/1   -like                                   
 120::304  1.4e-22 33.7% 0050203 00502031 1/1   )-binding Rossmann-fold domains         
 120::322  2.2e-22 31.4% 0046725 00467251 1/1   )-binding Rossmann-fold domains         
   5::331  2.5e-22 25.3% 0046113 00461131 1/1   -like                                   
 120::322  9.5e-22 30.8% 0048107 00481071 1/1   )-binding Rossmann-fold domains         
 120::277  1.6e-21 35.6% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
   5::151  9.6e-21 28.3% 0039779 00397791 1/1   -like                                   
   5::168  1.1e-20 28.8% 0042365 00423651 1/1   -like                                   
 121::292  3.9e-20 30.9% 0048673 00486731 1/1   )-binding Rossmann-fold domains         
 120::300  5.4e-20 30.3% 0048863 00488631 1/1   )-binding Rossmann-fold domains         
   5::138  3.5e-19 28.2% 0050001 00500011 1/1   -like                                   
 120::293  5.5e-19 30.1% 0047655 00476551 1/1   )-binding Rossmann-fold domains         
 119::300  4.1e-18 31.4% 0046253 00462531 1/1   )-binding Rossmann-fold domains         
 134::272    2e-17 31.1% 0038711 00387111 1/1   )-binding Rossmann-fold domains         
 133::294  2.5e-16 27.1% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
 123::322  1.2e-15 24.9% 0038567 00385671 1/1   )-binding Rossmann-fold domains         
 120::292  1.5e-15 29.7% 0046114 00461141 1/1   )-binding Rossmann-fold domains         
 138::273  1.6e-14 29.5% 0039780 00397801 1/1   )-binding Rossmann-fold domains         
 125::262  3.7e-14 28.8% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
 120::273  5.3e-14 31.5% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
   5::173  3.9e-13 31.8% 0038267 00382671 1/1   -like                                   
 117::273  1.9e-12 30.4% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
 133::278  3.4e-12 28.7% 0036744 00367441 1/1   )-binding Rossmann-fold domains         
   6::152  6.2e-10 26.7% 0047104 00471041 1/1   -like                                   
 156::295  1.2e-09 24.3% 0042366 00423661 1/1   )-binding Rossmann-fold domains         
   5::176  2.8e-09 26.1% 0045092 00450921 1/1   -like                                   
 131::250  4.4e-08 29.8% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
 121::267  6.8e-08 25.5% 0037437 00374371 1/1   )-binding Rossmann-fold domains         
 145::273  1.3e-07 24.6% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
   4::133  3.3e-07 27.8% 0046449 00464491 1/1   -like                                   
 155::270  5.8e-07 30.3% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
 155::240  6.1e-07 25.0% 0049864 00498641 1/1   )-binding Rossmann-fold domains         
 120::301  9.1e-07 20.3% 0047059 00470591 1/1   )-binding Rossmann-fold domains         
 155::239  9.5e-07 29.1% 0043337 00433371 1/1   )-binding Rossmann-fold domains         
 155::209  1.1e-06 42.3% 0053287 00532871 1/1   )-binding Rossmann-fold domains         
 155::203  1.8e-06 36.7% 0047178 00471781 1/1   )-binding Rossmann-fold domains         
 155::212    2e-06 36.2% 0051183 00511831 1/1   )-binding Rossmann-fold domains         
 155::212  2.1e-06 29.3% 0042429 00424291 1/1   )-binding Rossmann-fold domains         
 152::202  2.4e-06 33.3% 0039935 00399351 1/1   )-binding Rossmann-fold domains         
 153::241  3.3e-06 26.8% 0049519 00495191 1/1   )-binding Rossmann-fold domains         
 155::216  4.6e-06 33.9% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
 155::208  7.9e-06 42.6% 0046291 00462911 1/1   )-binding Rossmann-fold domains         
 155::185  9.3e-06 48.4% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
 155::212  9.4e-06 34.5% 0049117 00491171 1/1   )-binding Rossmann-fold domains         
 155::208  9.7e-06 34.6% 0052116 00521161 1/1   )-binding Rossmann-fold domains         
 154::242  1.1e-05 22.9% 0052837 00528371 1/1   )-binding Rossmann-fold domains         
 155::203  1.1e-05 30.6% 0043042 00430421 1/1   )-binding Rossmann-fold domains         
 155::203  1.1e-05 36.7% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
 155::208  1.2e-05 30.2% 0051996 00519961 1/1   )-binding Rossmann-fold domains         
 153::208  1.3e-05 36.0% 0038559 00385591 1/1   )-binding Rossmann-fold domains         
 155::200  1.3e-05 37.0% 0043041 00430411 1/1   )-binding Rossmann-fold domains         
 156::240  1.5e-05 28.0% 0037128 00371281 1/1   )-binding Rossmann-fold domains         
 155::241  2.1e-05 25.9% 0048293 00482931 1/1   )-binding Rossmann-fold domains         
 155::197  2.5e-05 45.0% 0046897 00468971 1/1   )-binding Rossmann-fold domains         
 155::245  2.5e-05 28.2% 0049026 00490261 1/1   )-binding Rossmann-fold domains         
 155::241  2.7e-05 27.2% 0051491 00514911 1/1   )-binding Rossmann-fold domains         
 153::245  2.9e-05 25.6% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
 155::208  2.9e-05 38.5% 0051925 00519251 1/1   )-binding Rossmann-fold domains         
  20::152  3.1e-05 26.1% 0044605 00446051 1/1   -like                                   
 155::272  3.2e-05 25.2% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
 155::241  4.1e-05 26.2% 0046034 00460341 1/1   )-binding Rossmann-fold domains         
 155::208  4.3e-05 33.3% 0041999 00419991 1/1   )-binding Rossmann-fold domains         
 155::228  4.4e-05 32.9% 0051991 00519911 1/1   )-binding Rossmann-fold domains         
 155::228  5.8e-05 32.8% 0051696 00516961 1/1   )-binding Rossmann-fold domains         
 155::208  6.4e-05 35.8% 0050721 00507211 1/1   )-binding Rossmann-fold domains         
 155::208  7.9e-05 35.2% 0040043 00400431 1/1   )-binding Rossmann-fold domains         
 153::208  9.5e-05 38.5% 0048614 00486141 1/1   )-binding Rossmann-fold domains         
 155::185  9.8e-05 45.2% 0046472 00464721 1/1   )-binding Rossmann-fold domains         
 150::212   0.0001 27.0% 0036194 00361941 1/1   )-binding Rossmann-fold domains         
 155::185  0.00014 45.2% 0049357 00493571 1/1   )-binding Rossmann-fold domains         
 132::190  0.00016 33.9% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
 154::251  0.00016 35.5% 0042207 00422071 1/1   )-binding Rossmann-fold domains         
   5::136  0.00018 25.0% 0046314 00463141 1/1   -like                                   
 155::245   0.0002 32.9% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
 155::229  0.00024 30.4% 0038324 00383241 1/1   )-binding Rossmann-fold domains         
 155::212  0.00027 30.4% 0042505 00425051 1/1   )-binding Rossmann-fold domains         
 155::273  0.00028 25.4% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
 155::212  0.00047 29.3% 0052529 00525291 1/1   )-binding Rossmann-fold domains         
 136::185  0.00052 28.6% 0047278 00472781 1/1   )-binding Rossmann-fold domains         
 149::212  0.00055 29.0% 0050776 00507761 1/1   )-binding Rossmann-fold domains         
   5::140  0.00058 22.9% 0047181 00471811 1/1   -like                                   
 155::200  0.00058 35.6% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
 155::184  0.00065 43.3% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
 155::208  0.00066 37.0% 0052744 00527441 1/1   )-binding Rossmann-fold domains         
   5::90   0.00068 29.1% 0047232 00472321 1/1   -like                                   
 153::184  0.00071 40.6% 0036007 00360071 1/1   )-binding Rossmann-fold domains         
 150::212   0.0008 30.2% 0035471 00354711 1/1   )-binding Rossmann-fold domains         
 155::212  0.00086 29.3% 0045076 00450761 1/1   )-binding Rossmann-fold domains         
   1::333


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSDNFKALVVNQESENFTREVKSIDKSFLKHGDVLVQVDYSDLNYKDALILNNGAKLVKEFPHIPGIDFA
00500401   1/1  ----------------------------------------------------------------------
00417381   1/1  ----mkalvldelggpevlelvelplpelgpgevlvkvhaaglnykDllartglypvvpglplvpGlefa
00508901   1/1  ----------------------------------------------------------------------
00508891   1/1  ----petmkalvltgpggpevleleevplpepgpgevlvkvlaaglnpsDllillglyplvlplplvlgh
00502041   1/1  ----------------------------------------------------------------------
00476541   1/1  ----Mkalvltgpgd...leleevplpepgpgevlvkvlaagingsDlhlirlglyplll..plvlGhEa
00487991   1/1  ----------------------------------------------------------------------
00485161   1/1  ----------------------------------------------------------------------
00512631   1/1  --etmkalvltgpggpevlelelevplpepgpgevlvkvlaaglnpsDllilsglyplvpplplvlgheg
00496851   1/1  -sktmkalvltgpgdpevleleevplpepgpgevlvkvlaaglnpsDllilrglyplvvplplvlGhega
00512641   1/1  ----------------------------------------------------------------------
00474811   1/1  ----------------------------------------------------------------------
00474801   1/1  ----mkalvltgpgdp..leleevplpepgpgevlvkvlaaglngsDllillglyplllelplvlGhEaa
00479941   1/1  smpltmkalvltgpgdp..leleevplpepgpgevlvkvlaagingsDlhillglyplplklplvlGhEg
00488621   1/1  ----ltlsllmkamkalvlggpgpleleevpvpepgpgevlvkvlaagingsDlhirrglypvp.klplv
00467241   1/1  ms.tmkalvltgpgdp..leleevpvpepgpgeVlvkvlaagingsDlhilrglypv..plplvlGhEga
00432751   1/1  ----mkAlvltgpgdp..leleevpvpepgpgevlvkvlaagicgtDlhiyrgglpllvklplvlGhEaa
00502021   1/1  lpltmkalvltgpgdp..leleevpvpepgpgeVlvkvlaagingsDlhirrglypvlp.lplvlGhEga
00513271   1/1  ----------------------------------------------------------------------
00429061   1/1  ----------------------------------------------------------------------
00408171   1/1  ----lslvitmkAavltgpggp..leleevpvpepgpgeVlvkvlaagicgtDlhilrglypl.vklplv
00486721   1/1  ----mtlslpltmkalvltgpgdp..leleevpvpepgpgeVlvkvlaagicgsDlhilr.glypvp.lp
00429051   1/1  ----mkAlvlygagdpevlrleevplpepgpgevlvkvkavgingtDlkilsggyp.vlklplilGhEaa
00502031   1/1  ----------------------------------------------------------------------
00467251   1/1  ----------------------------------------------------------------------
00461131   1/1  ----lllslpltmkaavltgpggp..leleevpvpepgpgevlvkvlaagicgsDllhirrglyp..lpl
00481071   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00397791   1/1  ----mkAavltgpgdp..leleevpvpepgpgeVlvkvlaagicgsDlhilrglyplllllllllvklpl
00423651   1/1  ----aaalpltmkalvltgpg...pleleevpvpepgpgevlvkvlatgicgtDlhilkgglplalvlkl
00486731   1/1  ----------------------------------------------------------------------
00488631   1/1  ----------------------------------------------------------------------
00500011   1/1  ----mkaavvlggpgpleleevplpep..gpgevlvkvlaagicgsDlhilrglyp.llklplvlGhEaa
00476551   1/1  ----------------------------------------------------------------------
00462531   1/1  ----------------------------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00385671   1/1  ----------------------------------------------------------------------
00461141   1/1  ----------------------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00382671   1/1  ----lilmkAvvvlatgdPkevlflkveeiplpalgpgevlvkviaagicgtDlailqgvyptkpvktig
00383791   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00471041   1/1  -----kAavllgpgdplrledvpvpe.lpgpgevlvkvaaagiCgtDlhilegllpglllvklPlvlGhE
00423661   1/1  ----------------------------------------------------------------------
00450921   1/1  ----mkallllglgk...lellevpePepgPgevlvrtlavgvcgtDlhvldgdlpg.velgiilGheiv
00423401   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00464491   1/1  ---kmkAlvllgpg...dlrleevpvpepgpgevlvkvaatgiCgsDlhlykhgdlgdllvklPlvlGHE
00421801   1/1  ----------------------------------------------------------------------
00498641   1/1  ----------------------------------------------------------------------
00470591   1/1  ----------------------------------------------------------------------
00433371   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00495191   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00521161   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00519961   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00482931   1/1  ----------------------------------------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00490261   1/1  ----------------------------------------------------------------------
00514911   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00519251   1/1  ----------------------------------------------------------------------
00446051   1/1  -------------------mvtnkqivlakrpegfPkpedfeleevplpepgdgevlvkvlylsvD....
00387841   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00419991   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00463141   1/1  ----stagkvikmkAavlreagkpl..eieevelpepgpgevlvkvvatGiChtDlhvldgalp..vplP
00484691   1/1  ----------------------------------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00525291   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00507761   1/1  ----------------------------------------------------------------------
00471811   1/1  ----stlgkvikmkAavlrgpgkp..leieevelpepgpgeVlvkvvatGiChsDlhvld.gllpvp.lP
00367851   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00472321   1/1  ----stagkvikmkAavlrgagkpleieevelpep..gpgeVlvkvvatGiCgtDlhvld.gllpvp.lP
00360071   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00450761   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GTVLESDNSKFIKGDEVILTGWRVGEIYFGGYSQFAKVNGDYLVKKPKDISSKQAMILGTAGLTALLCSF
00500401   1/1  ------------------------------------------------glsleeaAalglaglTAylall
00417381   1/1  GvvvavgeggfkvGdrVvalglglgetldGglaeyvvvpadllvplPdglsleeAaalptaglTAylaLv
00508901   1/1  -------------------------------------------------lsleeaAalplaglTAylalf
00508891   1/1  eaaGvVvevgsggfkvGdrVvvlllvlgllldGgfaeyvvvpadllvklPdg.sleeaaavlplagl...
00502041   1/1  -------------------------------------------------lsleeaaalplaglTAylall
00476541   1/1  aGvVvevGsgvtgfkvGdrVvvlpvlscgeceaclsglenlcenllfglllgllldGgfaeyvvvplaad
00487991   1/1  ----------------------------------------------------eeAAalplagltaylalv
00485161   1/1  -------------------------------------------------lsleeaAalplagltaylall
00512631   1/1  aGvVvevGsgvtgfkvGdrVvvllll.....dggfaeyvvvpadllvklpdgllsleeaaalpl......
00496851   1/1  GvVvevgsggfkvGdrVvvlplvlgllrdGgfaeyvvvpadllvklPdglsleeaa..............
00512641   1/1  -------------------------------------------------lsleeaAalplagltAylalv
00474811   1/1  -------------------------------------------------lsleeaAalplagltAylalv
00474801   1/1  GvVv.........GdrVvvll......ldggfaeyvvvpadllvklPdglsleeaaalplalgltaylal
00479941   1/1  aGvVvevGsgvtgfkvGdrVvvlplvgscgeceaclsglenlcenllllgllldGgfaeyvvvpadllvk
00488621   1/1  lGhEaaGvVvevGsgvdtgfkvGdrVvvlplvpscgeceaclsglenlcenllllllgllllgltldGgf
00467241   1/1  GvVvevGsgvtgfkvGDrVvglfiscgeceaclaglenlcenllllglggdlldgtlllsllglslllgl
00432751   1/1  GvVvevGsgvtglkvGdrVvvlplliscgecryclsglpnlcenllflgvlldGgfaeyvvvpaanlvkl
00502021   1/1  GvVvevlGsgvtgdlslfkvGdrVvglpviscgeceacllsglenlcpnllllglngglllgllldGgfa
00513271   1/1  -------------------------------------------------lsleeaAalpealltayhalv
00429061   1/1  ----------------------------------------------------------------------
00408171   1/1  lGhEaaGvVvevGsgvtgfkvGdrVvvlpliscgeCraclsgrpnlcenlrllnlkgllldgtlrlslgg
00486721   1/1  lvlGhEgaGvVvevGsgvtgfkvGDrVvvlflvscgeceaclsglenlcenlvlglggglllggttrlll
00429051   1/1  GvVeevGsgvtglkvGDrVvvll.....cgdgglaeyvvvdedllvklPeslsllevleaaallvallta
00502031   1/1  -------------------------------------------------lsleeaAalpeagltayhalv
00467251   1/1  -------------------------------------------------lsleeaaallealltay...h
00461131   1/1  PlvlGhEgaGvVvevGsgvtgfkvGdrVvvlpviscgeceaclsglenlcenllvlglagllldgtlrll
00481071   1/1  -------------------------------------------------lpleeaaallcplltay...h
00405511   1/1  -------------------------------------------------lsleeaaallcagltayhall
00397791   1/1  vlGhEaaGvVvevGsgvtgfkvGdrVvvlpllscgecraclsglenlcenllflgllldggfaeyvvvpa
00423651   1/1  plvlGhEavGvVvevGsgvtglkvGdrVvvlpllscgecpyclagrynlcegllflgvlgldGgfaeyvv
00486731   1/1  --------------------------------------------------pleeaaallcalltayhalv
00488631   1/1  -------------------------------------------------lsleeaAallcagltayhalv
00500011   1/1  GvVvavGsgvtglkvGdrVvvlplviscgeceacrsglenlcenllllglagllllgllldGgfaeyv--
00476551   1/1  -------------------------------------------------lsleeaaalpeplltayhalr
00462531   1/1  ------------------------------------------------glsleeaalllcalltay...h
00387111   1/1  ---------------------------------------------------------------pgltAyv
00367461   1/1  --------------------------------------------------------------lellsval
00385671   1/1  ----------------------------------------------------lplellallGcglltali
00461141   1/1  -------------------------------------------------lpleeaaallcalatay...h
00397801   1/1  -------------------------------------------------------------------Cal
00496861   1/1  ------------------------------------------------------Aasilllgltsylall
00432761   1/1  -------------------------------------------------lplelaaalglalltavlavl
00382671   1/1  nptgelpvvlGhEavgvViavGsnVsslkpGDrVvpivvs.....dgalaeyavvdenaliklpdel...
00383791   1/1  ----------------------------------------------pkdvdlrvllllpeigltale..a
00367441   1/1  --------------------------------------------------------------llglafgt
00471041   1/1  iaGvveevGegvtglkvGdrvvvllllscgtCraCraglenlCenllllGllldGgfaeyvvvparllvk
00423661   1/1  ----------------------------------------------------------------------
00450921   1/1  GeVvevGsnveglkvGdrVvvpallscgtclycrrgllnlcddlllgellglgrdGafaeyvlvpaadaf
00423401   1/1  ------------------------------------------------------------aGylavllaa
00374371   1/1  --------------------------------------------------agrlavleaalllervltgl
00445261   1/1  ----------------------------------------------------------------------
00464491   1/1  iaGvVvevGsgvtglkvGdrVvveplvscgeceycrrgrynlcenllflglppldGgfaeyvv-------
00421801   1/1  ----------------------------------------------------------------------
00498641   1/1  ----------------------------------------------------------------------
00470591   1/1  -------------------------------------------------ldllqaatllvnPltAylllt
00433371   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00495191   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00521161   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00519961   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00482931   1/1  ----------------------------------------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00490261   1/1  ----------------------------------------------------------------------
00514911   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00519251   1/1  ----------------------------------------------------------------------
00446051   1/1  Pymrgrmypvelgevmvgg.gvgevvesgvpgfkvGdlVv.........glggwaeyavvdadlllklpd
00387841   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00419991   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00480351   1/1  -------------------------------------------------------------gllldtall
00422071   1/1  ----------------------------------------------------------------------
00463141   1/1  lvlGHEgaGiVeevGegVtdlkvGdrVvllfllsCgeCryCrsglenlCenlgvlvllgvlldgtl----
00484691   1/1  ----------------------------------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00525291   1/1  ----------------------------------------------------------------------
00472781   1/1  -----------------------------------------------------------------ldifv
00507761   1/1  ----------------------------------------------------------------------
00471811   1/1  vvlGHEgaGvVeevGegVtgvkvGDrVvllflpscgeCryClsglenlCenlgalnlggvlpggtaeltv
00367851   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00472321   1/1  lvlGHEgaGiVeevGegVtd--------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00450761   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AIKAREELLLGEKVKDVLVTGASGGVGSIAVMILNKFGYDVTAVTGKAENEKYLRSLGAKNIINKADLDK
00500401   1/1  elakl......kpgetvlvhgAaGgvGsaaiqlakalGarviatagsdeklellkelGadhvinykeedf
00417381   1/1  alarlk----------------------------------------------------------------
00508901   1/1  alleraglkpge...tvlvtGAaGgvGslavqlAkalGarViatagseeklellrelGadevidykdlve
00508891   1/1  .ylallralggllkget...v-------------------------------------------------
00502041   1/1  elaglkls....pgetvlvhGAaGgVGllavqlAkalGasrViatagseeklellvkelGadevinykee
00476541   1/1  llvklPldglslee...llcagltayllllal--------------------------------------
00487991   1/1  eraglk......pgetVlvtgaaGgvGlaavqlAkalGarviatagseeklelakelGadhvinykdedf
00485161   1/1  llldlagllpg...ktvlvtGAaggiGsaaaqllaalGarViavdrseeklellkelgadvvidvtdeda
00512631   1/1  .............agllkpgetv-----------------------------------------------
00496851   1/1  .........................Vaiqlaka-------------------------------------
00512641   1/1  ...elaglkpge...tVlvhGAaGgvGlaavqlAkalGarViatagseeklelakelGadhvidyrdedl
00474811   1/1  ....raglkpgd...tVlvtGAaGgvGlaavqlakalGarViatdrspeklelakelGadhvidyrdedl
00474801   1/1  lelaglkp.........vlvl-------------------------------------------------
00479941   1/1  lPdg...................-----------------------------------------------
00488621   1/1  aeyvvvpadllvklPdglsleea-----------------------------------------------
00467241   1/1  llglGgfaeyvvvpadllvkllPdglsleea..................---------------------
00432751   1/1  pdglslelaalleplavtaha-------------------------------------------------
00502021   1/1  ey--------------------------------------------------------------------
00513271   1/1  raglkp....gd...tVlviGa.GgvGllaiqlakalGagrViatdispeklelakelGadhvinyrded
00429061   1/1  --------aklkpgktvlvtGAaggvGlaaaqlakalGarViatarseeklellkelGadvvidykdedl
00408171   1/1  lllggvlldgg-----------------------------------------------------------
00486721   1/1  ggkpllgflgdGgfaeyvvvpernlvkidPd---------------------------------------
00429051   1/1  ysalrr----------------------------------------------------------------
00502031   1/1  ...eraglkpgd...tVlvlGa.GgvGllavqlakalGasrViatdrspeklelakelGadhvinykded
00467251   1/1  alvrragvkpgd...tVlvlGa.GgvGllaiqlAkalgasrViavdlseeklelakelGadhvinykded
00461131   1/1  lggkslltldGlsgfaeyvvvparllvkilPdglslee................................
00481071   1/1  allrragvkpgd...tVlvlGa.GgvGllavqlAkalGasrviavdlsdeklelakelGadhvinykded
00405511   1/1  r....agllpgk...tvlvtGa.GgvGlaaaqlaaalGarViavdrseeklelarelgadvvidvtdedl
00397791   1/1  allvklpdgls-----------------------------------------------------------
00423651   1/1  vpaanlvklpdglsleeaalleplavta------------------------------------------
00486731   1/1  ...rragvkpgd...tVlvlGa.GgvGllavqlAkalGasrViavdlseeklelakelGadevinykded
00488631   1/1  ragvk.......pgdtVlviGa.GgvGllavqlAkalGarViavdrseeklelakelGadhvidykeedl
00500011   1/1  ----------------------------------------------------------------------
00476551   1/1  lagvkp....gd...tVlvlGa.GgvGllavqlAkalGasrViavdgspeklelakelGadhvinykded
00462531   1/1  alvrragvkpgd...tVlvlGa.GgvGllavqlAkalGasrViavdlseeklelakelGadhvinykdle
00387111   1/1  glleiakvkpge...tVlvlGa.GgvGllavqlaklaGagrviavdgsdeklelakelGadavvnykdle
00367461   1/1  hallraglvpGkt...VlviGa.GgiGlaaalaakalGakViatdrspekleqakelgadfvvvykdlse
00385671   1/1  glvevaklkpGk...tvlvlGl.GgvGllalllakaaGagrvigvdindeklelakelGathvvnykete
00461141   1/1  alvrragvkpgd...tVlvlGa.GgvGllavqlAkalgasrviavdlspeklelakelGadhvinpkded
00397801   1/1  tvayaalkraglkpgdtvlvvGaaGgvGllavqlakalgaarviavdlsdeklelakelgadhvinskee
00496861   1/1  evlki......kegkkVlvtGAtGgiGlavvrlllkrGykViaidrseekleklkelgadvvldvtdvee
00432761   1/1  aagvkp.......gktvlvlGa.GgvGlaaaqlakalGakVvavdiseeklelakelGadfvvvykd..e
00382671   1/1  .......aalltlaaltalkaireletlydlll-------------------------------------
00383791   1/1  lkrallelkpgs...rVlviGa.GgvGsaaaqllaaaGvgkvilvDrdeealerarrlgpdvvvdpie.d
00367441   1/1  gfllllelagvlpgktVlvfGl.GgvGlaaillakaaGagrviavdlndeklelakslGadlvvnpkdld
00471041   1/1  lpdglldleeaa----------------------------------------------------------
00423661   1/1  ---------------lplelgalvltlatavralllagvlpgakVlvlGa.GvvGlqaaalakalGageV
00450921   1/1  lvklPdelddeaaalleplsvtalrslvk......r----------------------------------
00423401   1/1  lllcrflgglgllltlagglagkkvlviGa.GgvGlaaarllaalGakVtvldrnpekleqleelgadav
00374371   1/1  gal.....agllpgkrvlViGa.GgiGleaAaalarlGakVtvvdrrpellerleelgakfvlltldeel
00445261   1/1  ----pkslpllelallltglltawlplllagllpgktvgviGl.GgiGlavarlakalGarViaydrspe
00464491   1/1  ----------------------------------------------------------------------
00421801   1/1  --------------DgigavsllkrllvdlpgkkvlvlGa.GgiGralalalaaagaevvvvnrtlekae
00498641   1/1  --------------krvLvTGgtGfiGsalaraLlerGaevvvldrseekleelleeleallggrvefve
00470591   1/1  dfvdlkp...Gndw..viqnaansavGklviqlakllGlktinvvrdrpdleelvdeLkalGadvvitee
00433371   1/1  --------------ktvLVTGatGfiGsalaraLlerGyrVvaldrdpekleellaelealgggvefveg
00532871   1/1  --------------lsgktvlVtGAtGgiGsalvrrLleagdvaevvalvrspek...leelgggvevv-
00471781   1/1  --------------mmmmkvlvtGAtGfiGsalvrelleagheVtalvRdpsklaallglgve-------
00511831   1/1  --------------llllmmmslegktvLVTGAtGfiGsalvrrLlerGyeVvaldrspekleelaalle
00424291   1/1  --------------mmlslkgkvvlvtGasggiGralaralaaaGarVvlldrseekleelaaelgrvla
00399351   1/1  -----------kskktilVtGATGylGrsvvraLlergypVralvRnpskakalallklpgv--------
00495191   1/1  ------------r.ktvlvTGatGgiGsalaraLlarGaeVvlldrlssglspekleellaellealggg
00502281   1/1  --------------mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsagkllnepgvevvegdltd
00462911   1/1  --------------skkvLvTGatGfiGsalvrrLlerGyeVialdrlssgsneekleellkelellg--
00481861   1/1  --------------kkvlvtGAsGgiGsalalllaargaevvlld-------------------------
00491171   1/1  --------------ktvlvTGatGgiGsalaraLlallllslaGaevvaldrspseealealaellalgg
00521161   1/1  --------------MslllllllllmlkgmkilVTGaaGfiGshlvrrLlerGyevvaldrspeklee--
00528371   1/1  -------------mkkvgiiGl.GlmGlslalalaraGfadeVvgydrnpeklekalelgatdliaatdl
00430421   1/1  --------------MkgmkvlvtGgtGfiGshlvraLleaGhevvvlvRnpskgkaaklelle-------
00527221   1/1  --------------llllkillslkgkkvlvtGAtGgiGralvkellargavskvialvRrpe-------
00519961   1/1  --------------MkvLvtGatGfiGshlvrrLlerghleVvgldrlssgleelle.lpgvefvegD--
00385591   1/1  ------------egkvvLVtGgsggiGraiaralaaaGarVvvvdrseeal......gggvlavaaDv--
00430411   1/1  --------------MsgkkvlvtGAtGfiGshlaraLleaGhevvalvRspekaalalal----------
00371281   1/1  ---------------kvlVTGgaGfiGsalvraLlerGyeevvvldrlesgakl....gpgvefvegDlt
00482931   1/1  --------------nktvlvTGatGgiGsalaraLlarGaeVvlldrlssgaseekleelaaelraaggp
00468971   1/1  --------------ktvlvTGatGgiGsalaraLlarpGaeVvaldrlsspekleal-------------
00490261   1/1  --------------ktvlvTGatGgiGsalaraLlarGaeVvaldrspeklealaaeleallpllllfel
00514911   1/1  --------------SKtvlvTGatGgiGsalaraLlerGaeVvlldrspekleellaeleallgggvefv
00530191   1/1  ------------kmmkvavtGAtGyiGralvrlLlerghpvvalvrlassasagkgvevvlg.dltdldl
00519251   1/1  --------------kkkilvtGatGfiGsalaraLlergyevialdrspekleellkll..vefvkgD--
00446051   1/1  llaeglklklre----------------------------------------------------------
00387841   1/1  --------------kkvlvtGAsGgiGsalalllakegaevvlvdrdeekalealagelldlgggalvlv
00460341   1/1  --------------gktvlvTGatGgiGsalaraLlarpGaeVvaldrltsagspeklealaael.gvef
00419991   1/1  --------------kkvLvTGgtGfiGshlaraLlerGaevvvldrlsegaeellaelealgprvefv--
00519911   1/1  --------------lllllllimmmlkgkkvlvtGAtGgiGralvkeLlergavskVtalvRrpekleel
00516961   1/1  --------------kgkrvlvtGAtGfiGshlvrrLlaeghvsevvalvrrpsk......llpgvevvvg
00507211   1/1  --------------ldmmslmgktvlvTGatGgiGsalaraLlarGaeVvlldrspekleelaaelea--
00400431   1/1  --------------MgkkvLvTGgtGfiGsalvraLlerGaevvvldrdpegaaellallealggprv--
00486141   1/1  ------------kgkvvlvtGgsggiGsalaralaaeGakvvlvdrseealae....gggalavaaDv--
00464721   1/1  --------------MgktvlvtGatGfiGsalaraLlarGaveVv-------------------------
00361941   1/1  ---------mdlkgkvalvtGasggiGraiaralaaaGarVvlldrneekleelaaelgrvlavvlDvtd
00493571   1/1  --------------llsllsslldllslkgktvlvTGatGgiGsa-------------------------
00480351   1/1  vllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvladrneek--------------------
00422071   1/1  -------------mk.VgivGAtGrvGrllvrlllahpgvevvavvsraeaaellkllg...........
00463141   1/1  ----------------------------------------------------------------------
00484691   1/1  --------------DgigavsllkrlgvdlpgkrvlviGa.Ggagraaalallalgaevtvvnrtlekae
00383241   1/1  --------------MgkrvLvTGgtGfiGshlvraLlerpGhevvvldrlpsgadallellalltlllsl
00425051   1/1  --------------kvalvTGassgiGraiAlalaaeGarVvltdrneealeela..ggkalavalDvtd
00352901   1/1  --------------fgalnlgrlllgllglvpctplgilellerlgidlsgkvalVtGasggiGraiall
00525291   1/1  --------------gdlsgkvalvtGassgiGlaiAralaaeGarVvltdrneleelaaelealggrvla
00472781   1/1  krlikelivvklpgkkvvviGa.GpvGlalAlalallgavgkVvl-------------------------
00507761   1/1  --------mlkgkv..alvTGassgiGlaiAralaaeGarVvltdlrneekleelaaellealggrvlav
00471811   1/1  ----------------------------------------------------------------------
00367851   1/1  --------------kgkkvlviGa.GgiGralaraLaeaGaevtvadrslekaealaael----------
00465291   1/1  --------------Pctplgvllllellgillllllmmlrlkgk--------------------------
00527441   1/1  --------------amdlgllsgkvvlvTGasggiGralaralaarGarvVvlldrsglleekleela--
00472321   1/1  ----------------------------------------------------------------------
00360071   1/1  ------------lellllialenllllllllllellllsllkpm--------------------------
00354711   1/1  ---------MslkgkvvlvTGasggiGralaralaaaGarVvlldrseekleelaaelggrvlavalDvt
00450761   1/1  --------------llvlllllllllslkgkvalvTGassgiGraiaralaaaGarVvlldrsseeklee


                         -         -         -         +         -         -         -:280
query           DARPLDKGLWDGVVDTVGGKILANALAQTRDNGIVAACGNASDYKLNTTVMPFIIRGVKLWGINSVTASI
00500401   1/1  veevleltggegvdvvldnvggetleaslkllapgGrivviGlasgynlelpvlplllkgltllgillgs
00417381   1/1  ----------------------------------------------------------------------
00508901   1/1  evleltggegvdvvldtvggetleaalallapgGrvvligllsgaplpldllplllkgltllgsllgtrl
00508891   1/1  ----------------------------------------------------------------------
00502041   1/1  dlvealkeltgggvdvvldtvggetleaaldalapgGrivliglasgyvleldlllllllllllllllkg
00476541   1/1  ----------------------------------------------------------------------
00487991   1/1  veavleltggrgvdvvldavggetleaaldllapgGrvvlvGlasgailplpllllllkgltllgsllgs
00485161   1/1  veal.agggvdvvvnnaggatlgallellapggrvvlvnllggllltrallplllkrgkgrivns.....
00512631   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00512641   1/1  veavkeltggrgvdvvldtvggetleaaldllapgGrlvlvgllsg..lpldllllllkgltllgsllgt
00474811   1/1  ..altggggvdvvldtvgg.tleaaldllrpgGrlvlvgllsggplplpllllllkgltllgsllgs...
00474801   1/1  ----------------------------------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00513271   1/1  lveavleltggrgvdvvidavggeatleaalellkpgGrivlvgvlgggnllelplpllllllkgltlvg
00429061   1/1  vealkeltggrgvdvvlnnvggetldaaldllapggrvvlvglisgynlpllllllllkgltllg-----
00408171   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00502031   1/1  lldlveavkeltggrgvdvvldavggpatleaalellrpgGrlvlvgvlsgpllllplpllllllkgltl
00467251   1/1  lveavkeltgggvdvvldavggpatleaalealrpgGrlvlvGvlggplllpldllllllkeltllgsll
00461131   1/1  ......................................................................
00481071   1/1  edlveavkeltgggvdvvldavggpatleaalellrpglGrivlvGvpggplpllpllllllkeltllgs
00405511   1/1  veavleltggvDvvvdaagvpatleealrllkpggrlvlvgvagg.llpldlarlllkgvnlrgsfl---
00397791   1/1  ----------------------------------------------------------------------
00423651   1/1  ----------------------------------------------------------------------
00486731   1/1  kdlveavkeltgggvdvvldavggpatleqalellrpglGrvvlvGvpggplpllpllllllkgltllgs
00488631   1/1  vaell.gggvdvvldtvggpleltleaalellrpgGrlvlvGlpgg.plpldllllllkgltilgslvgs
00500011   1/1  ----------------------------------------------------------------------
00476551   1/1  lveavleltggrgvdvvldavggeatleaalellrpgGrivlvgvlggglllplplpllllllkeltllg
00462531   1/1  dlveavkeltggrgvdvvidavggeatleaalelllrpgGrivlvGvpggpllplpllllllkgltilgs
00387111   1/1  dlaealkeltggegvdvvldnvggeeallaalrlllkpgGrvvlvGvisgyvlplpllelll--------
00367461   1/1  diieavaellatngggadividtagipgileeavdllkpggvivdvgladg.eltvplllvllkgvtivg
00385671   1/1  kvaeevkeltdgegvdvvieavgspqtlreaisvlkkpgGtvvlvgvpsgplellpivllvlssktvrgs
00461141   1/1  edlveavkeltgggvdvvleavgapaaleqalellrpggGrvvlvGvpgg.plplpllllllkeltllgs
00397801   1/1  dlveevleltggrgvdvvldavgaeatlelaldllapgGrlvlvGllgg.lleldllllllke-------
00496861   1/1  llkallklggvdvvihtagapvtelslsllkqllrvnvlgtlnllrallpll------------------
00432761   1/1  dvaeavleltggadvvidtagipgilreilrllkpggvivllgllpg.plplpladlllkgvt-------
00382671   1/1  ----------------------------------------------------------------------
00383791   1/1  laeallellggrgvDlvldcvdnfetlallidalkpggipvvsgagag..gqldpteillkgl-------
00367441   1/1  eevaeavleltgggvdvvveavgsvqallqaidavrpgwGtvvlvGllgkelelplv..lvlngltlr--
00471041   1/1  ----------------------------------------------------------------------
00423661   1/1  tvvDisperleqaeelGadlvvvpseedlaeavreltgkqgggaDlvitaagipgvlrealevmkpggvv
00450921   1/1  ----------------------------------------------------------------------
00423401   1/1  evdvsdtadleelvaea.....Dvvinaagipgatapllv------------------------------
00374371   1/1  vevvlaltvdvsdeegrlkavetleellgeaDvvivaagippataplllteellelm-------------
00445261   1/1  klelakelgadfvvvysdedsleel..lkgaDvvilhvpltlaleevlellkpggvvvdlgal-------
00464491   1/1  ----------------------------------------------------------------------
00421801   1/1  elaeelga..qgdvsdleeleeal..ggaDivvnatgaglpglllelllellkpggvvvd----------
00498641   1/1  gDlt......dpealeaaleevgvdvvihl----------------------------------------
00470591   1/1  elldedlkkllkeltkgggeevklalnavGGksatallrlLspggllvtyGglskepvtlptsllifkdl
00433371   1/1  Dlt......dpeslaaalagvrpdvvvhl-----------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00511831   1/1  al--------------------------------------------------------------------
00424291   1/1  vv--------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00495191   1/1  vefvqgDlt......dpeslaaalagvrldv---------------------------------------
00502281   1/1  pddlek----------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00491171   1/1  ve--------------------------------------------------------------------
00521161   1/1  ----------------------------------------------------------------------
00528371   1/1  aealkd.....aDvvilavptpavrevleell--------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00519961   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00371281   1/1  ......dpesleaaleevekfggvdvvihl----------------------------------------
00482931   1/1  gvefvqgDlt......dpeslaaalagvrld---------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00490261   1/1  lglldellggrvefvegDl......tdpesleaal-----------------------------------
00514911   1/1  qgDlt......dpeslaaaleevgvdvvvhn---------------------------------------
00530191   1/1  laaala..gvdvvflaagagatlalaeaaaaagvk-----------------------------------
00519251   1/1  ----------------------------------------------------------------------
00446051   1/1  ----------------------------------------------------------------------
00387841   1/1  advtdleavedlvealgg..advvvnnagvprkpgeerldllevnvlgtknlaealkkagpg--------
00460341   1/1  vqgDlt......dpeslaaalagvriDvvih---------------------------------------
00419991   1/1  ----------------------------------------------------------------------
00519911   1/1  aaegvevvvgDltdpesl----------------------------------------------------
00516961   1/1  Dltdplaealag.vdvvi----------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00361941   1/1  ee--------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00422071   1/1  ..........advvvdatppdvlaelaeallkagvdaVils-----------------------------
00463141   1/1  ----------------------------------------------------------------------
00484691   1/1  elaelladevvaldlddleeal.....ggaDlvin-----------------------------------
00383241   1/1  leklllllellgprvefve---------------------------------------------------
00425051   1/1  ee--------------------------------------------------------------------
00352901   1/1  LaraGatVtvtdrntenleeavkeaDivivavgvpglvkaellkpgavvidvdvtdpedve..-------
00525291   1/1  va--------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00507761   1/1  al--------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00354711   1/1  de--------------------------------------------------------------------
00450761   1/1  la--------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KRREFVWNEVKSLIDFEQLEKSIKTVSLEDLIDIYPKMLKGETSGRYIVDLNK-----------------
00500401   1/1  rllvldlllllelalelllllle-----------------------------------------------
00417381   1/1  ----------------------------------------------------------------------
00508901   1/1  lllelllllllglll-------------------------------------------------------
00508891   1/1  ----------------------------------------------------------------------
00502041   1/1  ltllgfllgslpellr.........................e----------------------------
00476541   1/1  ----------------------------------------------------------------------
00487991   1/1  rldlrellllvalgkilplvlithllel------------------------------------------
00485161   1/1  .......................skaalegltealalelagkgigvvV----------------------
00512631   1/1  ----------------------------------------------------------------------
00496851   1/1  ----------------------------------------------------------------------
00512641   1/1  lllelleelldl----------------------------------------------------------
00474811   1/1  ...r.lleelldllaegklkpvilit--------------------------------------------
00474801   1/1  ----------------------------------------------------------------------
00479941   1/1  ----------------------------------------------------------------------
00488621   1/1  ----------------------------------------------------------------------
00467241   1/1  ----------------------------------------------------------------------
00432751   1/1  ----------------------------------------------------------------------
00502021   1/1  ----------------------------------------------------------------------
00513271   1/1  sllgtra.................................elleea------------------------
00429061   1/1  ----------------------------------------------------------------------
00408171   1/1  ----------------------------------------------------------------------
00486721   1/1  ----------------------------------------------------------------------
00429051   1/1  ----------------------------------------------------------------------
00502031   1/1  vgsllgtr......edleelldll----------------------------------------------
00467251   1/1  ggr...........................lpleelpellel----------------------------
00461131   1/1  ...................................................-------------------
00481071   1/1  lvggr...........................lvleelpell----------------------------
00405511   1/1  ----------------------------------------------------------------------
00397791   1/1  ----------------------------------------------------------------------
00423651   1/1  ----------------------------------------------------------------------
00486731   1/1  lvgsraprdlpe----------------------------------------------------------
00488631   1/1  r......adleelldlvaeg--------------------------------------------------
00500011   1/1  ----------------------------------------------------------------------
00476551   1/1  sllgtredlpell---------------------------------------------------------
00462531   1/1  lvgg......redlpelldl--------------------------------------------------
00387111   1/1  ----------------------------------------------------------------------
00367461   1/1  svvl..rllleeal--------------------------------------------------------
00385671   1/1  lvggr...........................vpleelpeal----------------------------
00461141   1/1  lvggrrdleell----------------------------------------------------------
00397801   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00382671   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00367441   1/1  ----------------------------------------------------------------------
00471041   1/1  ----------------------------------------------------------------------
00423661   1/1  vdvaidqg.eltlpl-------------------------------------------------------
00450921   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00374371   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00464491   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00498641   1/1  ----------------------------------------------------------------------
00470591   1/1  tlrGfwltkwlkedpeekldt-------------------------------------------------
00433371   1/1  ----------------------------------------------------------------------
00532871   1/1  ----------------------------------------------------------------------
00471781   1/1  ----------------------------------------------------------------------
00511831   1/1  ----------------------------------------------------------------------
00424291   1/1  ----------------------------------------------------------------------
00399351   1/1  ----------------------------------------------------------------------
00495191   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00462911   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00491171   1/1  ----------------------------------------------------------------------
00521161   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00430421   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00519961   1/1  ----------------------------------------------------------------------
00385591   1/1  ----------------------------------------------------------------------
00430411   1/1  ----------------------------------------------------------------------
00371281   1/1  ----------------------------------------------------------------------
00482931   1/1  ----------------------------------------------------------------------
00468971   1/1  ----------------------------------------------------------------------
00490261   1/1  ----------------------------------------------------------------------
00514911   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00519251   1/1  ----------------------------------------------------------------------
00446051   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00460341   1/1  ----------------------------------------------------------------------
00419991   1/1  ----------------------------------------------------------------------
00519911   1/1  ----------------------------------------------------------------------
00516961   1/1  ----------------------------------------------------------------------
00507211   1/1  ----------------------------------------------------------------------
00400431   1/1  ----------------------------------------------------------------------
00486141   1/1  ----------------------------------------------------------------------
00464721   1/1  ----------------------------------------------------------------------
00361941   1/1  ----------------------------------------------------------------------
00493571   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00463141   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00383241   1/1  ----------------------------------------------------------------------
00425051   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00525291   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00507761   1/1  ----------------------------------------------------------------------
00471811   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00527441   1/1  ----------------------------------------------------------------------
00472321   1/1  ----------------------------------------------------------------------
00360071   1/1  ----------------------------------------------------------------------
00354711   1/1  ----------------------------------------------------------------------
00450761   1/1  ----------------------------------------------------------------------