[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ22049.1


[Show Plain Result]

## Summary of Sequence Search
   1::202
   6::202  1.8e-76 49.5% 0037473 00374731 1/1   hydrobiopterin biosynthesis enzymes-lik 
  15::204    9e-72 50.8% 0034957 00349571 1/1   hydrobiopterin biosynthesis enzymes-lik 
  16::201  2.2e-71 53.0% 0050713 00507131 1/1   hydrobiopterin biosynthesis enzymes-lik 
   1::202


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLVEDTDSKILDTKKVSDKEAEEAFKTILTWMGEDPSREGLLETPKRVVKAFKEYFGGYTEDAEKILEK
00374731   1/1  -----lllllleledeldleeieeavrelLealgedpdreglleTPkrvakaylelfsGldldpeevlet
00349571   1/1  --------------deldleeieeavrelLealgedpdreglleTPkRvakayleelfsGlrydlaevlt
00507131   1/1  ---------------eldleeieeavrellealgedpdreglleTPkRvakaylelfsgldldpaevlel


                         -         -         *         -         -         -         -:140
query           TFGDVEGYDDMVVEKNISVSSHCEHHMAPIVGTAHVAYIPNERVVGLSKLARVVEVFSKRLQTQERLTMQ
00374731   1/1  flne.egldelvlvkdieftslCehhllPffgkvhvaYiPdgkvvGlsklarlvdsfarrlqvqErltnq
00349571   1/1  tflnde.gldelvlvkdieftSlCehhllPffgkvhvaYiPdgkvvGlsklarlvdvfarrlqvqErltn
00507131   1/1  flne.egldelvlvkdieftslCehhllPffgkahvaYiPdgkvvGlsklarlvdvfarrlqvqErltnq


                         +         -         -         -         -         *         -:210
query           VAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNYFLGEFKKDLSVQNRYLRFISK--------
00374731   1/1  IadalvellkprgvaVvieAeHlcmtmrGvvktgsltvtsallGlfkedaslraeflslirg--------
00349571   1/1  qIadalvellkprgvaVvieAeHlcmlmRGvkktgsstvtsallGvfkedpslraeflslires------
00507131   1/1  iadalvellkpkgvaVvieAehlcmtmRGviktgsltvtsallGvFkedpalraeflslik---------