[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ22059.1


[Show Plain Result]

## Summary of Sequence Search
   1::189
   1::189  4.2e-48 29.9% 0046417 00464171 1/1   proteins                                
   1::189  1.8e-42 29.9% 0046267 00462671 1/1   proteins                                
   1::189  1.5e-40 27.3% 0049022 00490221 1/1   proteins                                
   1::189  2.6e-39 26.1% 0042957 00429571 1/1   proteins                                
   3::191  2.3e-32 25.4% 0049201 00492011 1/1   proteins                                
   1::189  3.6e-31 25.1% 0049548 00495481 1/1   proteins                                
   1::190    5e-30 25.7% 0049640 00496401 1/1   proteins                                
   1::190  9.3e-27 21.7% 0049507 00495071 1/1   proteins                                
   2::175  5.5e-25 19.9% 0048395 00483951 1/1   proteins                                
   2::186  3.7e-23 22.2% 0052813 00528131 1/1   proteins                                
   1::189  1.8e-22 21.3% 0043718 00437181 1/1   proteins                                
   1::130  2.9e-22 28.3% 0051281 00512811 1/1   proteins                                
   2::188  9.8e-18 19.8% 0049241 00492411 1/1   proteins                                
   1::187  8.5e-14 20.3% 0051820 00518201 1/1   proteins                                
   1::130  3.1e-12 21.1% 0051705 00517051 1/1   proteins                                
   2::188  3.1e-11 23.2% 0051274 00512741 1/1   proteins                                
   1::189  1.9e-09 17.6% 0036778 00367781 1/1   proteins                                
   1::187    7e-07 20.5% 0044895 00448951 1/1   proteins                                
   2::188  9.3e-06 19.7% 0036210 00362101 1/1   proteins                                
   2::188  2.8e-05 19.3% 0045773 00457731 1/1   proteins                                
   4::185   0.0002 18.9% 0053358 00533581 1/1   proteins                                
   3::129  0.00053 21.3% 0052810 00528101 1/1   proteins                                
   1::189


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIFLLYGHYNEKSFNAAIRDTFIKTAEKNGNTVDCVDLYKDKFNPVFAGEQAGEDVLDHRRRIEKCDI
00464171   1/1  mmmkiLiinasprenslsraladaalegleeaghevevldLydlpfdpcldcddcaakftppegltaeqe
00462671   1/1  mmmkiLiingspregsltraladaalegleeaghevevidLyalpfdpcldcddcaalftppegltpeqk
00490221   1/1  Msm.kiliiygSprkgsntralaeaaaegleeagaevelidladldldpcldcdlcaakgkcvelltlaq
00429571   1/1  mmmkiliingspregsntralaeaaleglkepgaevevidLydlnidpcldcddcaallkppegltlsle
00492011   1/1  --KiliiygSprkgsntralaeaaae.....gaevelidladldlppclgdlecakgkcplpddvealle
00495481   1/1  MkkiliiygSprlkgsntralaeaaaegleealpgaevelidladlplppcdgclecalktgacvlpddv
00496401   1/1  smmkiliiygSprlkgsntralaeaaaegleealpgaevelidladldl.Plldedlcigcfaclkelse
00495071   1/1  M.kiliivgsprkgsntralaeaaaegleeallelhpgaevelidladlnlPlldedllgallcltegqc
00483951   1/1  -mkilvivGSlrkgsnnrklaealaelleeagaevelidladlnlplldgc...pddvqelrekiaeaDa
00528131   1/1  -llledllllddlpvldldllllidllellimstpmkilvlygSprrgsntrklaeaaaegleaagaeve
00437181   1/1  M.KvlviygSprgknsntrklaeaaaeglee.gaevevidladlpippclgcllcalgfkdgkcaqkvad
00512811   1/1  aPM.kiliiygSpr..gnteklaeaiaegleeagaevelidladlplppclgdlecltegecvlpddvee
00492411   1/1  -mkilvivgSlrkgsntrklaeaaaellee.gaevelidladlplplldgdleglpddvqellekllaaD
00518201   1/1  MmkiliiygSpt..GnTeklaeaiaegleavagvevelidvsdadp.................edlleaD
00517051   1/1  MmkilvvygSpr..gnTeklaeaiaegaeeagaevelidvaelplpeclacgdcplkddlealledllea
00512741   1/1  -gekkilvlygSlt..gntellaealaegleaagvevelvdladldlpdl.............leellda
00367781   1/1  mmmkvlivygSmy..gnteklaeaiaeglreagvevelidlsdtdl.............delleelldad
00448951   1/1  kkmkkvlivygSmy..gnteklAeaiaeglkeagvevelldlselda..........peilelleellda
00362101   1/1  -mkililYgS..qtGnTeklAeaiaeglge.gvevdlvdledadl.................edlleyda
00457731   1/1  -mkililYgSlt..GnTeklAeaiaeglg..gaevelidlddad.................ledleeyda
00533581   1/1  ---ilivYgSmt..GnTeklAeaiaegleeagvevellnlsdadp.................edlldyda
00528101   1/1  --KvlivYgSmt..GnTeklAeaiaeglgeagvevelldladadp.................edlldada


                         -         -         *         -         -         -         -:140
query           IVLIAPIWNFRMPAIVEGWIDKVLSPPWAYTFKKLVGNYGYPMGNLKDKKAIIFCTYGSPRLAVTTFFLN
00464171   1/1  ealalgecvlkddvaeeqekllaADvivfafPlywfgvPalLKgwiDrvlragfafgyt...gd..gpvg
00462671   1/1  qalalgkcplpddvealqekllaADaivfafPlywfsvPallKgwiDrvlraGfafgyggn.....gpvg
00490221   1/1  eellalkegllpddvaellekllaaDaivfgtPvyngsvpaqlKnfiDrvlragfafgygg.....lgpv
00429571   1/1  ealalgecalpddveellekllaaDaivfafPlYwfsvPallKnfiDrvlragfafgytg.....ngpeg
00492011   1/1  kllaaDaivfgtPeyngsvpaqlKnfiDrvsrlgfafgydg.......pggllkgKpaalvvtsggpggg
00495481   1/1  qallalsdallekllaaDaivfgtPeyngsvpallKnfiDrvlragfafgytg.....lggggllkgKpa
00496401   1/1  gecvlpddvaallekllaaDaivfgtPeyngsvpallKnfiDrvlrpgfafgygg.....lgpvgllkgK
00495071   1/1  alpddvaeliekllaaDalvfvtPeYngsiPalLKnfiDrvsrp...................lkgKpvl
00483951   1/1  ivlvtPeYngsipgaLKnalDwlsrpwlagkpvalvavsgggsgglraleqlrqvlaflgalvipsqvli
00528131   1/1  iidladlpl.plgcidclpddvaelledllaadgivvgsPtyngsmpallKnflDrllllg.........
00437181   1/1  dvaelleklleaDaivfgsPvyngsvpaqlKafiDrlsrlg..............pvgllkgKvvavvtt
00512811   1/1  lleklleaDaiilgtPtyngsvpaqlknflDrvlrlgf..............ggllkgKp----------
00492411   1/1  glvfatPeYngsipglLKnalDrlsrpg...............gkllagKpvalvstsggal....gglr
00518201   1/1  giilGsPtygggvpgqlkdfldrl...............sglwlgllkgKpaavfgsgggsgggfedalk
00517051   1/1  DgiilGsPtyfgsvsaqlkafldrlsrlw..............lsgalagKpaavftssg----------
00512741   1/1  dalvVgsPtyngsipgllkafldrllglg..................lkgkkvavfgsgggsggavkqlr
00367781   1/1  aiilGsPtynggvlpqlknfldalsgld..................lkgKpvavfgsgggsgeavdllre
00448951   1/1  dalilgsPtyggeippqlkdfldllggla..................lkgKlaavfgsggwfggavkt..
00362101   1/1  iilgtptygygelpdnlkdfldfllkld..................lkgkkvavfglgdssggyee..fc
00457731   1/1  iilgtptygygelpdnlkdfldellgld..................lsgkkvavFglgdssgggeefcea
00533581   1/1  iilgsptygggeppedevkdfldrl...................lgklkgkkvavfgsggsgfgealkll
00528101   1/1  lilgtptygggelpddlvkdfldll..................k.ldlkgkkvavfgsg-----------


                         +         -         -         -         -         *         -:210
query           LPIRRLKRGVFHMCGIYNIVYRRYFAVPFVTDEKRKEFLEDVKKTANNI---------------------
00464171   1/1  llkgKkallivtsGgpeeaysegggagalldlllpylrgilgflGitvv---------------------
00462671   1/1  llkgKkalvivtsGgpeeayseggpaggledlllpylrgilgflGitvl---------------------
00490221   1/1  gllkgKpaalvvtsggpggayaaggaegtlrqlltpllrgilgflgitv---------------------
00429571   1/1  llkgKkvllvvtsggpeeaysaggpnggvddlltpllrgilgflGmtvl---------------------
00492011   1/1  y.....lesalrylrtilaflgmtvvgsvyaegvdfgevekdeealerara-------------------
00495481   1/1  alivtsggpgg....glaaesalrylltilgflgmpvvglvlaegvl.l---------------------
00496401   1/1  paalvvtsggpgg...glaaetalrpl.ltilgflgmtvvglvlaegv.a--------------------
00495071   1/1  lvstsgg.........gglrallylrtilgflgatvvpsvvalgvaagel--------------------
00483951   1/1  lgagfdedgvltdeellerledlldelvkllklle-----------------------------------
00528131   1/1  ....gsvgllagKpaavfvtgggsggelaleqlrtllahlgmivvp------------------------
00437181   1/1  sgggga........eaalqylrtilaflgmivvglvyaegvll.gpgde---------------------
00512811   1/1  ----------------------------------------------------------------------
00492411   1/1  aleqlrlilgflgavvvpsvvvalgkalelfdedgllldeellerlke----------------------
00518201   1/1  ylrkllkelgmivvglgyfagalggspygallaegapdeedlerare-----------------------
00517051   1/1  ----------------------------------------------------------------------
00512741   1/1  ellaelgalvvplgvllv.............dedpdeealerieelge----------------------
00367781   1/1  llkelgakvvgepllv........kgapdeedletaeelgkrlaellkk---------------------
00448951   1/1  ........leellkelgakvvplleikgspt.dleeleelgkelakt-----------------------
00362101   1/1  aalkkldkrlaelGakrvgegllidysfddskavlggsfvglaldedn----------------------
00457731   1/1  lklldkllaelgakvvgegllad...ydfeasfalwldglfiglalpe----------------------
00533581   1/1  eellkelgakvvglpllag............vpdeedlerarelg-------------------------
00528101   1/1  ----------------------------------------------------------------------