[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ22091.1


[Show Plain Result]

## Summary of Sequence Search
   1::388
   1::384   4e-120 39.7% 0050240 00502401 1/1   roquinate synthase-like                 
   2::385 4.4e-105 37.5% 0043359 00433591 1/1   roquinate synthase-like                 
   1::382 8.5e-105 38.3% 0048580 00485801 1/1   roquinate synthase-like                 
   3::365 9.6e-103 36.8% 0041672 00416721 1/1   roquinate synthase-like                 
   1::382  6.5e-84 38.4% 0047653 00476531 1/1   roquinate synthase-like                 
   1::382  1.3e-82 37.2% 0047854 00478541 1/1   roquinate synthase-like                 
   6::380  4.9e-48 25.5% 0036562 00365621 1/1   roquinate synthase-like                 
   1::380  4.4e-45 25.5% 0044392 00443921 1/1   roquinate synthase-like                 
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQKYNWNYPTTMWVGENRINDVASACKNLNIKKPLLVTDNGLAQSVIVKNTLSILKEGGIIAALYSNVVG
00502401   1/1  llrlnnflfllptrivfGkgalkelgellkklgikkvlivtdgglakklglldkvldalkeagievvvfd
00433591   1/1  -lnfvfllptkiifgagalaelgeelkrlgakralivtdgslkklglldrvldalkeagievvvfdgvep
00485801   1/1  lenmlnftfllptrivfgkgaldelgellkk.g.kkvlivtdggvakllglldrvlaale..gievvvfd
00416721   1/1  --lflfllptkiifgagaleelgellkrlg.krvlivtdggllkklglldrvldaleeagievvvfdgve
00476531   1/1  mllfvfllptrivfgagaldelgellkelg.krvlivtdegvaklgg.drvlallkeagiev.vfddvep
00478541   1/1  mllflfllptrivfgegaldelgellkelg.krvlivtdegvaklglldrvlasLeeagievvvfdgvep
00365621   1/1  -----mtllvllillpykvvigegaldelgelladlgakrvlvvtdenvakl.yldrllelledagievl
00443921   1/1  mellvvlillpyeivigeglleelgell.....srvlvvtdenvakl.yldavlall...gvlvivfpgg


                         -         -         *         -         -         -         -:140
query           NPTGTNVNEGADYYKKNNCDGVIAFGGGSGLDVGKAVAFMSGQNLPIWDFEDVGDNWTKANSDKIAPIIA
00502401   1/1  gvepnPtletveeavelarefgadliiAlGGGSviDaAKaiallllnggdlldyl.....gvklvlkkal
00433591   1/1  nPtletvekavelarefgadviiAlGGGsviDtAKaiallltnpgladildll.....gvklllkpalpl
00485801   1/1  gvepnptletveelvellrefgadviiAlGGGsviDlAKavaalllnprgi.dfidipttllaqvd.kal
00416721   1/1  pnptletvekavelarefgadviialGGGsviDtAKaialllgnpgdlldll.....gvklllkpalpli
00476531   1/1  npsletveelvealleagadvviAlGGGsviDlAKavallrg.......................lplia
00478541   1/1  nptletveeale....eradviiAlGGGsviDlAKavaylrg.......................lplia
00365621   1/1  lelrllvlvvpdgeasksletverlvdalleaglevdRddvvialGGGvvlDlagfvAatylrg......
00443921   1/1  epnksletlekivealleagldRssvlialGGGsviDlagfvAatylrg.....................


                         +         -         -         -         -         *         -:210
query           VPTTAGTGSETGRASVILNEETGVKNIIFHPKFLPSIVILDPILTVGLPAKMTAATGMDALAHNLEAYCA
00502401   1/1  pliaiPTtaGTGSEvtrfavitdeetgvKlgiasplllPdlailDPeltltlPprltaatgmDaltHaiE
00433591   1/1  iavPTtagtgsevtalavitdeeggvklgiasplllPdlailDpeltltlPprltaatglDalahaiEay
00485801   1/1  pliavPTtagtGsevtktavitnlegglKnligafallPdlvilDpellltlPprltaaggaDalkhaiE
00416721   1/1  avPTtagtGsevtplavitdeegk.klgi..pallPdlailDpeltltlPprltaatglDalahaiEayv
00476531   1/1  vPTtagtgsevtgkavitdpe.gvkknlvgafllPdlvivDpellltlPprltaaggaDalahaleayvs
00478541   1/1  iPTtagtgsevtgkavitdpegknkiglfspal.PdlvivDpellltlParltaaggaDalkhaleayvs
00365621   1/1  .................vpfiqvPTTllAsvDasvggktginlpggknligafyq...PkavliDpdlla
00443921   1/1  ..vpfiavPTTllaavdssvggkaginlpggknl...igafyqPkavllDpellltlParelaaGlaeal


                         -         -         -         +         -         -         -:280
query           PGYHPMADGIALEGMRLIDKWLLEAVSNGSNIEARMNMLTAASMGSTAFQKGLGAIHSLSHPVNALNNIH
00502401   1/1  ayvsvlanplsdalalealrlilenlpkavkdpddlearenmllastlAgiafaglglnaglgavHalah
00433591   1/1  vsllanpltdalalealrllleylpkavad..dlearenlllAatlaglafanaglgavHalahalgalf
00485801   1/1  ayvsliadapltdllalealrllaenlpravadgvdlkarevlldaselagraflnaglgasgaaHaleh
00416721   1/1  sllanpltdalalealrllleylpravad..dlearenlllAatlAglafgnaglgavHalahalgalfd
00476531   1/1  llanlenllgellslltdalallaielileslpialadveadeldlearallllasllaglafsnaglga
00478541   1/1  llallekllglllnpltdalallalrllleklpvaladpedeavtlearalmllasllaglgfsraglgl
00365621   1/1  tlParllaaGiaeaikhaleadallfslleeyadalallllelllelllralldpealeelilrsieakl
00443921   1/1  khaleadaelflllegnplsdlaaeelirrlieakakvvaaderelglr...............ailnlg


                         -         *         -         -         -         -         +:350
query           HGLSNAIFMPYVLTFNKDVIENKIIKICDYLELKDRSFDGFVNWVLDLRKKLDMPHKLSEVIDEKDFDID
00502401   1/1  plgalygipHGlanaillpavlrfnaeaaperlarlaralgllglsdeeaaealiealeellkslgipts
00433591   1/1  dlpHGlavAillpavlrfnapaaperlaelaralglllkglsleeaaealiealrellkslglpttlsdl
00485801   1/1  algalygllHGeavaiglpavlaynlglapeklaelaral.lgllglpveeaadalieallelkkslglp
00416721   1/1  lpHGeavAillpavlrfnaeaaperlaelaralgvdlkglsleeaaealiealrellkslglpttlsel.
00476531   1/1  gHalahalgallgykfdllHGeavAiglpavlrlnllaael...................ierlrellkk
00478541   1/1  gHalghalgallglfdllHGeavAiglpavlrlnllaael...................ierllellkkl
00365621   1/1  avvaadelegglrallnlghtfaHaleagltygllHGeavaigmllalrls...............erlg
00443921   1/1  htlgHalelllgygllHGeavaiglvlalrla..............erlglld...eierllellkrlgl


                         -         -         -         -         *         -         -:420
query           RLSKMALADPSTGGNPKKLTEDDMRIMYQNSMTGELFK--------------------------------
00502401   1/1  lsel.gvdeedldllaelalkdrllltnprpltl------------------------------------
00433591   1/1  gvdeed.ldalaelaladrlllgnprpltledvle-----------------------------------
00485801   1/1  tllselgvdeedl..delaelalaldrlllgn--------------------------------------
00416721   1/1  gvdeedleelaelal-------------------------------------------------------
00476531   1/1  lglpttlkdlgvdeedllellalakkaldgrl--------------------------------------
00478541   1/1  glpttlkdl.gvdeedllellelakkarlgdl--------------------------------------
00365621   1/1  llsleeierlldllkalglpttlkdlglke----------------------------------------
00443921   1/1  ptsl.......gldledlleallldkkvrg----------------------------------------