[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for pubi0:AAZ22111.1


[Show Plain Result]

## Summary of Sequence Search
   1::284
  54::247  9.9e-38 26.4% 0046500 00465001 1/1    subunit of glutamate synthase, C-termi 
  53::247  1.4e-36 27.3% 0047995 00479951 1/1    subunit of glutamate synthase, C-termi 
   1::284


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANLKNTEKKTKAQSMGMHSEVLTGRTQQKFFNPDEGENLYYFGTYDVDFNKRTELDVKDMTAPEANKEI
00465001   1/1  -----------------------------------------------------ldldldglldrellell
00479951   1/1  ----------------------------------------------------eldldldgllddelleli


                         -         -         *         -         -         -         -:140
query           DNLMSQGFGTIVIKNPQGKHSLGVGILNKLNLIFEGSLGYFGMGSCDGPTVRINGRVGWSCAENLMAGKV
00465001   1/1  leaiekgekvlllldivnvdravgallsgeiakrygriglpddtititveGsaGqslGaflakgltleve
00479951   1/1  leaiedlelvllnlkilntdrfvgarlsgeiakrygaaglpgtititleGsaGqslGaflakgltltveG


                         +         -         -         -         -         *         -:210
query           VIEKNAGSCFGAAIRGGDLICKGSVGARTGIDMKGGTIIVGGDAGAFTGFMMQRGRIIILGDVGINLGDS
00465001   1/1  GdAndyvGkgmsgGkivvlgnagdsfvalgnvivGnvalygatgGklfvrGnAGerfgvrnsgativveG
00479951   1/1  dandyvGkgmsgGkivvlgnagdllgaeenviiGnvvlygatgGklfvrGnAGerfgvrnsgativveG.


                         -         -         -         +         -         -         -:280
query           MYDGTIFIGGKIGSFGSDAVPADLTASDQDWLKRKLKVAEIGEKFDVSKMTKIVAGKKLWNYDNLEPHEK
00465001   1/1  .vgdhlceymtgGtvvvlGdtgrnfgagmtgGviyvl---------------------------------
00479951   1/1  vgdhlceymtgGtvvvlGdtgrnfgagmtgGviyvld---------------------------------


                         -         *         -         -         -         -         +:350
query           KGAI------------------------------------------------------------------
00465001   1/1  ----------------------------------------------------------------------
00479951   1/1  ----------------------------------------------------------------------