[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL02981.1


[Show Plain Result]

## Summary of Sequence Search
   1::103
   1::100  PF01491 0.0% 46  Frataxin-like domain 
   1::103


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYH
PF01491         lteseyhkladellesleekleelaeeadadiDvelsggvltlefenkgtyvinkqepnkqiWlsspksg


                         -         -         *         -         -         -         -:140
query           FFYEQGEWTNRAGLELMAILTEELNIKFDTRPT-------------------------------------
PF01491         pkrfdldegeWidkrdgsellelLeeelse----------------------------------------