[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03054.1


[Show Plain Result]

## Summary of Sequence Search
   1::172
  22::117  PF05158 0.0% 19.1176470588235  RNA polymerase Rpc34 subunit 
   1::172


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLFLVQAKILSNSNIAKDKLTVTKELQKSIQQKEVSNERLTQEEIDNIYKTLGIFEEIKEYEKSDNSRV
PF05158         ---------------------ptveeiakfinelgitkvrLseediqqlvevLvyDgklekvkngegyrl


                         -         -         *         -         -         -         -:140
query           PRLLNKNYYKLTDPREERRSDNIALEQDDTGMLTTDTDLEWDDTGILPPAQNSAVSDKLKEAVDDYISEL
PF05158         qratkqeklklsskrrad............................a-----------------------


                         +         -         -         -         -         *         -:210
query           QNEKLSKDTSPKQVEAITHPMQEAIPTPLALS--------------------------------------
PF05158         ----------------------------------------------------------------------