[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03106.1


[Show Plain Result]

## Summary of Sequence Search
   1::169
   3::168  PF00873 0.0% 32.7272727272727  AcrB/AcrD/AcrF family 
   1::169


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDYYAETIMAERLSMLPGVAQIQVYGSQQYAVRVQIDPVKMAVNNIGLDQVSNIISSANVNLPTGALYGT
PF00873         --dlaesnikdqlsrveGVgdvqliGgsekavriwldpqklaklgltltdvvsalkeqnvqvaaGqlegq


                         -         -         *         -         -         -         -:140
query           DIYSSIRAPGQLQNVKEYNELILTYKNGNPLFLKNIGKTIDSVANNKIAAWYRDKPGVILAIQKQPDTTN
PF00873         qeelliraqgrlqsaediekiivksqdgskvrlrDvAkvelgaeeeriaatlngkpavllavkklpg.an


                         +         -         -         -         -         *         -:210
query           TIEIVDSIKEVLPLLRRQIPEGININIMF-----------------------------------------
PF00873         aievvkavkekleelketlPegveivvv------------------------------------------