[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03110.1


[Show Plain Result]

## Summary of Sequence Search
   1::125
  51::125  PF02321 0.0% 34.6666666666667  Outer membrane efflux protein 
   1::125


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPPLKQQRHEQETTLKILVGRIPENIVNGLIYRNKPIDYFPALPVLPKILPSELLEQRPDIKAAEQNLLA
PF02321         --------------------------------------------------lalalennpdlkaaeaeiea


                         -         -         *         -         -         -         -:140
query           ADVNLKTIKATYFPQISLTGLLGFGSNKLNTLFTNSAETWQVDGNIAGPIFDFGK---------------
PF02321         aeaelklakaqflPtlslsgsygyegngsegggddggtgttsvgltlsqplfdgg---------------