[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03216.1


[Show Plain Result]

## Summary of Sequence Search
   1::231
   7::185  PF00596 0.0% 39.766081871345  Class II Aldolase and Adducin N-terminal domain 
   1::231


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDIKYNLAAAYRIMAYLSLDDHTYTHLSARPKNAVFYYIYPFGLRFEEVTTENLLKVSLDGQILEGEEYQ
PF00596         ------laaasrlladrglvegtgGniSvrdp.defl.itpsgvdkeeltaedlvvvdldsgevvegkek


                         -         -         *         -         -         -         -:140
query           YNKTGYFIHGSIYKTRPDISAIFHYHTPAAIAVSALKCGLLPISQWALHFYDRISYHNYNSLVLDADKQS
PF00596         glkps.aetalHaaiyrarpdvravvHtHspaavalsallkeglppltqeaaklylgdevpvvpyarpgt


                         +         -         -         -         -         *         -:210
query           SRLVTDLKQNYVMLLRNHGAITCGKTIHEAMFYTYHLEQACKTQCLLNSTKEQELIIPSVEICKQTVKDL
PF00596         eel.....gealaealkpgakavllrnHGllvvGetveeAvarae-------------------------


                         -         -         -         +         -         -         -:280
query           LSFEEDLGKRDWAAWLRLVKM-------------------------------------------------
PF00596         ----------------------------------------------------------------------