[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03501.1


[Show Plain Result]

## Summary of Sequence Search
   1::94
  11::78   PF04993 0.0% 44.1176470588235  TfoX N-terminal domain 
   1::94


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNQNAFTEYVKELLEPYGSVVVRVMFGGYGIYKGGVMIGIIKSNELYFKSDLSTYEYFQSFGSESFVYQS
PF04993         ----------lellselgevtaRrmFGgyglyadglmfAlvadgelyLkadeetraefeaagsepykyek


                         -         -         *         -         -         -         -:140
query           KGKLVTLKKSQAQFLRFPRSLQLQ----------------------------------------------
PF04993         kgktvaks--------------------------------------------------------------