[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03713.1


[Show Plain Result]

## Summary of Sequence Search
   1::445
   3::119  PF10396 0.0% 50.4347826086956  GTP-binding protein TrmE N-terminus 
 227::330  PF01926 0.0% 32.0388349514563  GTPase of unknown function 
 217::394  PF02421 0.0% 27.1676300578035  Ferrous iron transport protein B 
 219::268  PF00350 0.0% 40  Dynamin family 
 217::310  PF08477 0.0% 28.2352941176471  Miro-like protein 
 218::249  PF02492 0.0% 34.375  CobW/HypB/UreG, nucleotide-binding domain 
 280::338  PF02492 0.0% 23.728813559322  CobW/HypB/UreG, nucleotide-binding domain 
   1::445


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           METIFAQSSAFGKAGVAVFRISGPKSLEVLQLLTGRKDFKSRLMYYQQITVPETKELIDNVMVVYFKSPG
PF10396         --tIvAlatatgrsaiaiiRiSGskakeilekllkgkslesrkatyskild.esgeiidevlvlyfkapn
PF01926         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SFTGEDVVEIHTHGSKAISIMLTNALLNIAGIRLAEAGEFTKRAFLNNKFDLTAAEGIADLINAETIMQH
PF10396         sytgedvvElqchGgpvvvkeileailel.girlaepGEFtkRAflngk---------------------
PF01926         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KQAIRQASGKLEALYNNWRSQLLKMLSLLEAYIDFPDEDIPDTVLNEVTNTHTILVNTISEYLNDNRKGE
PF10396         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LLRSGLKLAIIGPPNVGKSSLLNFLMQRDIAIVSNIAGTTRDIIEGHLDIGGYPIILQDTAGIREESSDI
PF10396         ----------------------------------------------------------------------
PF01926         ----------------GKStLinaltgkakakvanypgtTrdpnegkvkledgkeitliDtpGiiegadk
PF02421         ------tvalvGnpnvGKttlfnaltgak.qkvgNwpGvTVekkegklklkgkeveivDLPGiYsLsays
PF00350         --------avvGsqSaGKSSllnaLlgedilprgpg.ptTrrplvlql.........g------------
PF08477         ------kvvvvGdkgvGKssllsqlvgeefpkkklpeeikgdtlavktlevdvdtellelwdlggr....
PF02492         -------tvltGflGsGKTtLleklleknraglkiaviv------------------------------l
PF02492         -------tvltGflGsGKTtLleklleknraglkiaviv------------------------------l


                         -         *         -         -         -         -         +:350
query           IEQEGIKRAINSAKTADIKIIMFDAEKLDSSINEDIINLIDENTITIINKIDLIEASKIFSIENKYKCLR
PF10396         ----------------------------------------------------------------------
PF01926         keg.elgkkflealeeadllllvvdasepltkndleladlelekkkkpll--------------------
PF02421         ee.ekvardylleekpdviinvvDasnlernLyLtlqllel.gvpvvvalnmiDeaekkgikidlkkLse
PF00350         ----------------------------------------------------------------------
PF08477         .....eelkkehelllkkadaillvydltd----------------------------------------
PF02492         iEttGlaepaplldlksdlgldavvavvdvknltegedkpekledqlaaAdliilnKi------------
PF02492         iEttGlaepaplldlksdlgldavvavvdvknltegedkpekledqlaaAdliilnKi------------


                         -         -         -         -         *         -         -:420
query           VSVKNNIALSSILKNIENIAENMAGFTETPYITNQRHRNYLQQALSHLTAFSLDNDLVLATEDIRMTARC
PF10396         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF02421         lLgvpvvktvarkk..kgieelleaiievaekeekekkllkyse--------------------------
PF00350         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IGAITGVINVEEILGEIFKNFCIGK---------------------------------------------
PF10396         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF00350         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------
PF02492         ----------------------------------------------------------------------