[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03749.1


[Show Plain Result]

## Summary of Sequence Search
   1::1181
 293::734  PF07733 0.0% 53.3980582524272  Bacterial DNA polymerase III alpha subunit 
   6::177  PF02811 0.0% 30  PHP domain 
1025::1099 PF01336 0.0% 18.0555555555556  OB-fold nucleic acid binding domain 
   1::1181


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILN
PF07733         ----------------------------------------------------------------------
PF02811         -----vdlHlHtkfsalDGinsieelvkqakelgvkaialTDHdnvagapdfyeaakkagikpiiGvEid
PF01336         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IKYDIDIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCL
PF07733         ----------------------------------------------------------------------
PF02811         akkrkksl.dltllsvnevglknlkklssaallygytyr.pripksllekvaregliillahpegevfea
PF01336         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LARNEEQAMLFARKLQEILGDRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAH
PF07733         ----------------------------------------------------------------------
PF02811         alqkpleelekileeylelieqdgfaleinrselrkk---------------------------------
PF01336         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DVLLCISAGVTKEYLDRKTVSENCYFKSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATE
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTEYFARLNYELDIICNMNFAGYFLIVSDFIKW
PF07733         ------------eeglkerlleeik.................erlekElevIekmgfadyflivsdlvkk
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMPDFDIDFCQERREEVINYVRS
PF07733         akkkgilvGpgRGSaagslVayllgiTevdPlkydllFerFlnperdsmPDiDiDfederreevidyvke
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREVPELANAAKGN
PF07733         kYGkervaqiatfgtlaaksairdvgrvlglplkevdklaklipke....itlekaleeekelkelieee
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA
PF07733         e.........evkelielakkleglkrttsqHagGvviskeeltdfvPlqkaakdkakvtqfdkddledl
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLK
PF07733         gllKlDfLGlktltvikkalklikknkgieidlekiplddkkvykllqkgetlGvfqlesrgmrsllkrl
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           PDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYT
PF07733         kPktfedlvalsaLyrpgpvqagnvddyikrkngkeeveyihpeleeiLketygvivyqEqvmqiaqila
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LGAADLLRRAMGKKIKKEMEEQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQT
PF07733         gfslgeAdllrramgkkkeeeleklkeefiegak------------------------------------
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           AYLKANYPAAFLVACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIP
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           RLDRGIQKISKDTVVKPRCDIAGAIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINS
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           KLLENLIKSGCFDELHDNRLQLLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLA
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           FYEFEAMGLFISNHPLTEYQEIFSRLNILNTADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLVLS
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------
PF01336         --------------------------------------------VtvkGrVtsis..drsggkvafitlr


                         -         -         -         -         *         -         -:1120
query           DPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGGIKLTAKSFSSIEDAINNKQFELQFYPQNH
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------
PF01336         Dgtgriqvvlfr.eeatklaenlkeGdvvrvtGrvkrrpggelelkvek---------------------


                         -         -         +         -         -         -         -:1190
query           EELRQIVTLLAARINNEDQSNAKATIYLQSADVKNFVAKITLPEKFLLQGQDFEILKGYSK---------
PF07733         ----------------------------------------------------------------------
PF02811         ----------------------------------------------------------------------
PF01336         ----------------------------------------------------------------------