[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03816.1


[Show Plain Result]

## Summary of Sequence Search
   1::122
  13::114  PF04002 0.0% 44.1176470588235  Protein of unknown function (DUF2466) 
   1::122


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKQKIINKNINASWSSWIDYLKVNMGNMRLEQFRILFLNKKNILIADEVLSQGTIDQAAVYPREIIKRAL
PF04002         ------------spedvaeylkeeladekqEefvvllldtknrliaveevseGtlnsasvhpReifkral


                         -         -         *         -         -         -         -:140
query           FNEASSLILVHHHPSGSPEPSKANIHMTNKIVEKCQTINIIVLNLICSYEYK------------------
PF04002         kenaaavilaHnhPsgdpepSqaDielTkrlkealellgikllD--------------------------