[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for rcon0:AAL03819.1


[Show Plain Result]

## Summary of Sequence Search
   1::249
  43::98   PF09411 0.0% 21.2765957446809  Lipid A 3-O-deacylase (PagL) 
 145::207  PF09411 0.0% 26.530612244898  Lipid A 3-O-deacylase (PagL) 
   1::249


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLLLIAAASTALLTSGLSFADCDMNSSVDSSTNSSMSSSVENQWYLKLNAGGVIFNKTKPKGADFKLN
PF09411         ------------------------------------------ssklyleagigvallsktrde.......
PF09411         ------------------------------------------ssklyleagigvallsktrde.......


                         -         -         *         -         -         -         -:140
query           NIKSNIKSNTGFTGEIGAGYYIMDNLRTDLTIGTVASSHLKKSKTYPDGNSFSVKNKPTIVSVLLNGYVD
PF09411         ..dkdlgtafqFedqlglGyqfgdrasv------------------------------------------
PF09411         ..dkdlgtafqFedqlglGyqfgdrasv------------------------------------------


                         +         -         -         -         -         *         -:210
query           FVDLSMFKVFAGAGVGAAFVKEKIHSKDIKGGVTDTFNGTTKNKTNFAYQLSLGTSFEVAQGVKAELVYS
PF09411         ----ss.klyleagigvallsktrde...........dkdlgtafqFedqlglGyqfgdra..svgl---
PF09411         ----ss.klyleagigvallsktrde...........dkdlgtafqFedqlglGyqfgdra..svgl---


                         -         -         -         +         -         -         -:280
query           WRDYGKTKNTTKTINGDKVKFGGTHYKGHNLMAGLRFDM-------------------------------
PF09411         ----------------------------------------------------------------------
PF09411         ----------------------------------------------------------------------